KEGG   Homo sapiens (human): 2077Help
Entry
2077              CDS       T01001                                 

Gene name
ERF, CHYTS, CRS4, PE-2, PE2
Definition
(RefSeq) ETS2 repressor factor
  KO
K09434  ETS domain-containing transcription factor ERF
Organism
hsa  Homo sapiens (human)
Disease
H02160  Craniosynostoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2077 (ERF)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2077 (ERF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets HSF_DNA-bind
Motif
Other DBs
NCBI-GeneID: 2077
NCBI-ProteinID: NP_006485
OMIM: 611888
HGNC: 3444
Ensembl: ENSG00000105722
Vega: OTTHUMG00000182788
Pharos: P50548(Tbio)
UniProt: P50548 A0A024R0L4
Position
19q13.2
AA seq 548 aa AA seqDB search
MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDP
DEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFID
VGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARR
LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRG
GPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGG
SHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPLPPMAPETPPV
PSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPP
PPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPL
KLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQ
LSLEHRDS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccccggcggacacagggtttgccttcccggattgggcctacaagccagagtcg
tcccctggctcaaggcagatccagctgtggcactttatcctggagctgctgcggaaggag
gagtaccagggcgtcattgcctggcagggggactacggggaattcgtcatcaaagaccct
gatgaggtggcccggctgtggggcgttcgcaagtgcaagccccagatgaattacgacaag
ctgagccgggccctgcgctattactataacaagcgcattctgcacaagaccaaggggaaa
cggttcacctacaagttcaatttcaacaaactggtgctggtcaattacccattcattgat
gtggggttggctgggggtgcagtgccccagagtgccccgccagtgccgtcgggtggtagc
cacttccgcttccctccctcaacgccctccgaggtgctgtcccccaccgaggacccccgc
tcaccaccagcctgctcttcatcttcatcttccctcttctcggctgtggtggcccgccgc
ctgggccgaggctcagtcagtgactgtagtgatggcacgtcagagctggaggaaccgctg
ggagaggatccccgcgcccgaccacccggccctccggatctgggtgccttccgagggccc
ccgctggcccgcctgccccatgaccctggtgtcttccgagtctatccccggcctcggggt
ggccctgaacccctcagccccttccctgtgtcgcctctggccggtcctggatccctgctg
ccccctcagctctccccggctctgcccatgacgcccacccacctggcctacactccctcg
cccacgctgagcccgatgtaccccagtggtggcggggggcccagcggctcagggggaggc
tcccacttctccttcagccctgaggacatgaaacggtacctgcaggcccacacccaaagc
gtctacaactaccacctcagcccccgcgccttcctgcactaccctgggctggtggtgccc
cagccccagcgccctgacaagtgcccgctgccgcccatggcacccgagaccccaccggtc
ccctcctcggcctcgtcatcctcttcttcttcttcctccccattcaagtttaagctccag
ccgcccccactcggacgccggcagcgggcagctggggagaaggccgtagccggtgctgac
aagagcggtggcagtgcaggcgggctggctgagggggcaggggcgctagccccaccgccc
ccgccaccacagatcaaggtggagcccatctcggaaggcgagtcggaggaggtagaggtg
actgacatcagtgatgaggatgaggaagacggggaggtgttcaagacgccccgtgcccca
cctgcaccccctaagcctgagcccggcgaggcacccggggcatcccagtgcatgcccctc
aagctacgctttaagcggcgctggagtgaagactgtcgcctcgaagggggtgggggcccc
gctgggggctttgaggatgagggtgaggacaagaaggtgcgtggggaggggcctggggag
gctggggggcccctcaccccaaggcgggtgagctctgacctccagcatgccacggcccag
ctctccctggagcaccgagactcctga

DBGET integrated database retrieval system