KEGG   Homo sapiens (human): 2079
Entry
2079              CDS       T01001                                 

Gene name
ERH, DROER
Definition
(RefSeq) ERH mRNA splicing and mitosis factor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: ER
Other DBs
NCBI-GeneID: 2079
NCBI-ProteinID: NP_004441
OMIM: 601191
HGNC: 3447
Ensembl: ENSG00000100632
Vega: OTTHUMG00000171323
Pharos: P84090(Tbio)
UniProt: P84090 A0A024R6D4
Structure
PDB: 
2NML 1W9G

Position
14q24.1
AA seq 104 aa
MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDF
IDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
NT seq 315 nt   +upstreamnt  +downstreamnt
atgtctcacaccattttgctggtacagcctaccaagaggccagaaggcagaacttatgct
gactacgaatctgtgaatgaatgcatggaaggtgtttgtaaaatgtatgaagaacatctg
aaaagaatgaatcccaacagtccctctatcacatatgacatcagtcagttgtttgatttc
atcgatgatctggcagacctcagctgcctggtttaccgagctgatacccagacataccag
ccttataacaaagactggattaaagagaagatctacgtgctccttcgtcggcaggcccaa
caggctgggaaataa

DBGET integrated database retrieval system