KEGG   Homo sapiens (human): 2081Help
Entry
2081              CDS       T01001                                 

Gene name
ERN1, IRE1, IRE1P, IRE1a, hIRE1p
Definition
(RefSeq) endoplasmic reticulum to nucleus signaling 1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    2081 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    2081 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    2081 (ERN1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    2081 (ERN1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2081 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2081 (ERN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2081 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     2081 (ERN1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IRE family
   2081 (ERN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ribonuc_2-5A Pkinase_Tyr PQQ_2 PQQ APH Kdo CytochromB561_N
Motif
Other DBs
NCBI-GeneID: 2081
NCBI-ProteinID: NP_001424
OMIM: 604033
HGNC: 3449
Ensembl: ENSG00000178607
Vega: OTTHUMG00000178879
Pharos: O75460(Tchem)
UniProt: O75460
Structure
PDB: 

Position
17q23.3
AA seq 977 aa AA seqDB search
MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP
VLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYMGK
KQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYF
DYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKV
MHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMV
HEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWL
LIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSR
DVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQ
KELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRASNHSLCSG
SSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPY
YFHEPPEPQPPVTPDAL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccggcggctgctgctgctgctgacgctgctgctgcccggcctcgggattttt
ggaagtaccagcacagtgacgcttcctgaaaccttgttgtttgtgtcaacgctggatgga
agtttgcatgctgtcagcaagaggacaggctcaatcaaatggactttaaaagaagatcca
gtcctgcaggtcccaacacatgtggaagagcctgcctttctcccagatcctaatgatggc
agcctgtatacgcttggaagcaagaataatgaaggcctgacgaaacttccttttaccatc
ccagaattggtgcaggcatccccatgccgaagttcagatggaatcctctacatgggtaaa
aagcaggacatctggtatgttattgacctcctgaccggagagaagcagcagactttgtca
tcggcctttgcagatagtctctgcccatcaacctctcttctgtatcttgggcgaacagaa
tacaccatcaccatgtacgacaccaaaacccgagagctccggtggaatgccacctacttt
gactatgcggcctcactgcctgaggacgacgtggactacaagatgtcccactttgtgtcc
aatggtgatgggctggtggtgactgtggacagtgaatctggggacgtcctgtggatccaa
aactacgcctcccctgtggtggccttttatgtctggcagcgggagggtctgaggaaggtg
atgcacatcaatgtcgctgtggagaccctgcgctatctgaccttcatgtctggggaggtg
gggcgcatcacaaagtggaagtacccgttccccaaggagacagaggccaagagcaagctg
acgcccactctgtatgttgggaaatactctaccagcctctatgcctctccctcaatggta
cacgagggggttgctgtcgtgccccgcggcagcacacttcctttgctggaagggccccag
actgatggcgtcaccattggggacaagggggagtgtgtgatcacgcccagcacggacgtc
aagtttgatcccggactcaaaagcaagaacaagctcaactacttgaggaattactggctt
ctgataggacaccatgaaaccccactgtctgcgtctaccaagatgctggagagatttccc
aacaatctacccaaacatcgggaaaatgtgattcctgctgattcagagaaaaagagcttt
gaggaagttatcaacctggttgaccagacttcagaaaacgcacctaccaccgtgtctcgg
gatgtggaggagaagcccgcccatgcccctgcccggcccgaggcccccgtggactccatg
cttaaggacatggctaccatcatcctgagcaccttcctgctgattggctgggtggccttc
atcatcacctatcccctgagcatgcatcagcagcagcagctccagcaccagcagttccag
aaggaactggagaagatccagctcctgcagcagcagcagcagcagctgcccttccaccca
cctggagacacggctcaggacggcgagctcctggacacgtctggcccgtactcagagagc
tcgggcaccagcagccccagcacgtcccccagggcctccaaccactcgctctgctccggc
agctctgcctccaaggctggcagcagcccctccctggaacaagacgatggagatgaggaa
accagcgtggtgatagttgggaaaatttccttctgtcccaaggatgtcctgggccatgga
gctgagggcacaattgtgtaccggggcatgtttgacaaccgcgacgtggccgtgaagagg
atcctccccgagtgttttagcttcgcagaccgtgaggtccagctgttgcgagaatcggat
gagcacccgaacgtgatccgctacttctgcacggagaaggaccggcaattccagtacatt
gccatcgagctgtgtgcagccaccctgcaagagtatgtggagcagaaggactttgcgcat
ctcggcctggagcccatcaccttgctgcagcagaccacctcgggcctggcccacctccac
tccctcaacatcgttcacagagacctaaagccacacaacatcctcatatccatgcccaat
gcacacggcaagatcaaggccatgatctccgactttggcctctgcaagaagctggcagtg
ggcagacacagtttcagccgccgatctggggtgcctggcacagaaggctggatcgctcca
gagatgctgagcgaagactgtaaggagaaccctacctacacggtggacatcttttctgca
ggctgcgtcttttactacgtaatctctgagggcagccacccttttggcaagtccctgcag
cggcaggccaacatcctcctgggtgcctgcagccttgactgcttgcacccagagaagcac
gaagacgtcattgcacgtgaattgatagagaagatgattgcgatggatcctcagaaacgc
ccctcagcgaagcatgtgctcaaacacccgttcttctggagcctagagaagcagctccag
ttcttccaggacgtgagcgacagaatagaaaaggaatccctggatggcccgatcgtgaag
cagttagagagaggcgggagagccgtggtgaagatggactggcgggagaacatcactgtc
cccctccagacagacctgcgtaaattcaggacctataaaggtggttctgtcagagatctc
ctccgagccatgagaaataagaagcaccactaccgggagctgcctgcagaggtgcgggag
acgctggggtccctccccgacgacttcgtgtgctacttcacatctcgcttcccccacctc
ctcgcacacacctaccgggccatggagctgtgcagccacgagagactcttccagccctac
tacttccacgagcccccagagccccagcccccagtgactccagacgccctctga

DBGET integrated database retrieval system