KEGG   Homo sapiens (human): 2081
Entry
2081              CDS       T01001                                 

Gene name
ERN1, IRE1, IRE1P, IRE1a, hIRE1p
Definition
(RefSeq) endoplasmic reticulum to nucleus signaling 1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
  Element
N01011  IRE1a-XBP1 signaling pathway
N01012  Mutation-caused aberrant PSEN1 to IRE1a-XBP1 signaling pathway
N01013  IRE1a-JNK signaling pathway
N01034  Mutation-caused aberrant SNCA to IRE1a-XBP1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    2081 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    2081 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    2081 (ERN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2081 (ERN1)
   05012 Parkinson disease
    2081 (ERN1)
   05016 Huntington disease
    2081 (ERN1)
   05017 Spinocerebellar ataxia
    2081 (ERN1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2081 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2081 (ERN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     2081 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     2081 (ERN1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IRE family
   2081 (ERN1)
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal APH Kdo CytochromB561_N
Other DBs
NCBI-GeneID: 2081
NCBI-ProteinID: NP_001424
OMIM: 604033
HGNC: 3449
Ensembl: ENSG00000178607
Vega: OTTHUMG00000178879
Pharos: O75460(Tchem)
UniProt: O75460
Structure
PDB: 

Position
17q23.3
AA seq 977 aa
MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDP
VLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYMGK
KQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYF
DYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKV
MHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMV
HEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWL
LIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSR
DVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQ
KELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRASNHSLCSG
SSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKR
ILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAH
LGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAV
GRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQ
RQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQ
FFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDL
LRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPY
YFHEPPEPQPPVTPDAL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgccggcccggcggctgctgctgctgctgacgctgctgctgcccggcctcgggattttt
ggaagtaccagcacagtgacgcttcctgaaaccttgttgtttgtgtcaacgctggatgga
agtttgcatgctgtcagcaagaggacaggctcaatcaaatggactttaaaagaagatcca
gtcctgcaggtcccaacacatgtggaagagcctgcctttctcccagatcctaatgatggc
agcctgtatacgcttggaagcaagaataatgaaggcctgacgaaacttccttttaccatc
ccagaattggtgcaggcatccccatgccgaagttcagatggaatcctctacatgggtaaa
aagcaggacatctggtatgttattgacctcctgaccggagagaagcagcagactttgtca
tcggcctttgcagatagtctctgcccatcaacctctcttctgtatcttgggcgaacagaa
tacaccatcaccatgtacgacaccaaaacccgagagctccggtggaatgccacctacttt
gactatgcggcctcactgcctgaggacgacgtggactacaagatgtcccactttgtgtcc
aatggtgatgggctggtggtgactgtggacagtgaatctggggacgtcctgtggatccaa
aactacgcctcccctgtggtggccttttatgtctggcagcgggagggtctgaggaaggtg
atgcacatcaatgtcgctgtggagaccctgcgctatctgaccttcatgtctggggaggtg
gggcgcatcacaaagtggaagtacccgttccccaaggagacagaggccaagagcaagctg
acgcccactctgtatgttgggaaatactctaccagcctctatgcctctccctcaatggta
cacgagggggttgctgtcgtgccccgcggcagcacacttcctttgctggaagggccccag
actgatggcgtcaccattggggacaagggggagtgtgtgatcacgcccagcacggacgtc
aagtttgatcccggactcaaaagcaagaacaagctcaactacttgaggaattactggctt
ctgataggacaccatgaaaccccactgtctgcgtctaccaagatgctggagagatttccc
aacaatctacccaaacatcgggaaaatgtgattcctgctgattcagagaaaaagagcttt
gaggaagttatcaacctggttgaccagacttcagaaaacgcacctaccaccgtgtctcgg
gatgtggaggagaagcccgcccatgcccctgcccggcccgaggcccccgtggactccatg
cttaaggacatggctaccatcatcctgagcaccttcctgctgattggctgggtggccttc
atcatcacctatcccctgagcatgcatcagcagcagcagctccagcaccagcagttccag
aaggaactggagaagatccagctcctgcagcagcagcagcagcagctgcccttccaccca
cctggagacacggctcaggacggcgagctcctggacacgtctggcccgtactcagagagc
tcgggcaccagcagccccagcacgtcccccagggcctccaaccactcgctctgctccggc
agctctgcctccaaggctggcagcagcccctccctggaacaagacgatggagatgaggaa
accagcgtggtgatagttgggaaaatttccttctgtcccaaggatgtcctgggccatgga
gctgagggcacaattgtgtaccggggcatgtttgacaaccgcgacgtggccgtgaagagg
atcctccccgagtgttttagcttcgcagaccgtgaggtccagctgttgcgagaatcggat
gagcacccgaacgtgatccgctacttctgcacggagaaggaccggcaattccagtacatt
gccatcgagctgtgtgcagccaccctgcaagagtatgtggagcagaaggactttgcgcat
ctcggcctggagcccatcaccttgctgcagcagaccacctcgggcctggcccacctccac
tccctcaacatcgttcacagagacctaaagccacacaacatcctcatatccatgcccaat
gcacacggcaagatcaaggccatgatctccgactttggcctctgcaagaagctggcagtg
ggcagacacagtttcagccgccgatctggggtgcctggcacagaaggctggatcgctcca
gagatgctgagcgaagactgtaaggagaaccctacctacacggtggacatcttttctgca
ggctgcgtcttttactacgtaatctctgagggcagccacccttttggcaagtccctgcag
cggcaggccaacatcctcctgggtgcctgcagccttgactgcttgcacccagagaagcac
gaagacgtcattgcacgtgaattgatagagaagatgattgcgatggatcctcagaaacgc
ccctcagcgaagcatgtgctcaaacacccgttcttctggagcctagagaagcagctccag
ttcttccaggacgtgagcgacagaatagaaaaggaatccctggatggcccgatcgtgaag
cagttagagagaggcgggagagccgtggtgaagatggactggcgggagaacatcactgtc
cccctccagacagacctgcgtaaattcaggacctataaaggtggttctgtcagagatctc
ctccgagccatgagaaataagaagcaccactaccgggagctgcctgcagaggtgcgggag
acgctggggtccctccccgacgacttcgtgtgctacttcacatctcgcttcccccacctc
ctcgcacacacctaccgggccatggagctgtgcagccacgagagactcttccagccctac
tacttccacgagcccccagagccccagcccccagtgactccagacgccctctga

DBGET integrated database retrieval system