KEGG   Homo sapiens (human): 2091
Entry
2091              CDS       T01001                                 
Symbol
FBL, FIB, FLRN, Nop1, RNU3IP1
Name
(RefSeq) fibrillarin
  KO
K14563  rRNA 2'-O-methyltransferase fibrillarin [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    2091 (FBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    2091 (FBL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     2091 (FBL)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    2091 (FBL)
SSDB
Motif
Pfam: Fibrillarin GCD14 PCMT FtsJ Methyltr_RsmB-F
Other DBs
NCBI-GeneID: 2091
NCBI-ProteinID: NP_001427
OMIM: 134795
HGNC: 3599
Ensembl: ENSG00000105202
Pharos: P22087(Tbio)
UniProt: P22087
Structure
Position
19:complement(39834458..39846379)
AA seq 321 aa
MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG
GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGE
KRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDI
VGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQP
DQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE
PYERDHAVVVGVYRPPPKVKN
NT seq 966 nt   +upstreamnt  +downstreamnt
atgaagccaggattcagtccccgtgggggtggctttggcggccgagggggctttggtgac
cgtggtggtcgtggaggccgagggggctttggcgggggccgaggtcgaggcggaggcttt
agaggtcgtggacgaggaggaggtggaggcggcggcggcggtggaggaggaggaagaggt
ggtggaggcttccattctggtggcaaccggggtcgtggtcggggaggaaaaagaggaaac
cagtcggggaagaatgtgatggtggagccgcatcggcatgagggtgtcttcatttgtcga
ggaaaggaagatgcactggtcaccaagaacctggtccctggggaatcagtttatggagag
aagagagtctcgatttcggaaggagatgacaaaattgagtaccgagcctggaaccccttc
cgctccaagctagcagcagcaatcctgggtggtgtggaccagatccacatcaaaccgggg
gctaaggttctctacctcggggctgcctcgggcaccacggtctcccatgtctctgacatc
gttggtccggatggtctagtctatgcagtcgagttctcccaccgctctggccgtgacctc
attaacttggccaagaagaggaccaacatcattcctgtgatcgaggatgctcgacaccca
cacaaataccgcatgctcatcgcaatggtggatgtgatctttgctgatgtggcccagcca
gaccagacccggattgtggccctgaatgcccacaccttcctgcgtaatggaggacacttt
gtgatttccattaaggccaactgcattgactccacagcctcagccgaggccgtgtttgcc
tccgaagtgaaaaagatgcaacaggagaacatgaagccgcaggagcagttgacccttgag
ccatatgaaagagaccatgccgtggtcgtgggagtgtacaggccaccccccaaggtgaag
aactga

DBGET integrated database retrieval system