KEGG   Homo sapiens (human): 2107Help
Entry
2107              CDS       T01001                                 

Gene name
ETF1, D5S1995, ERF, ERF1, RF1, SUP45L1, TB3-1
Definition
(RefSeq) eukaryotic translation termination factor 1
  KO
K03265  peptide chain release factor subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    2107 (ETF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2107 (ETF1)
   03012 Translation factors [BR:hsa03012]
    2107 (ETF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     2107 (ETF1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Release factors
   2107 (ETF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eRF1_2 eRF1_3 eRF1_1 acVLRF1 baeRF_family10 Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 2107
NCBI-ProteinID: NP_004721
OMIM: 600285
HGNC: 3477
Ensembl: ENSG00000120705
Vega: OTTHUMG00000129199
Pharos: P62495(Tbio)
UniProt: P62495
Structure
PDB: 

Position
5q31.2
AA seq 437 aa AA seqDB search
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaccccagtgctgccgacaggaacgtggagatctggaagatcaagaagctc
attaagagcttggaggcggcccgcggcaatggcaccagcatgatatcattgatcattcct
cccaaagaccagatttcacgagtggcaaaaatgttagcggatgagtttggaactgcatct
aacattaagtcacgagtaaaccgcctttcagtcctgggagccattacatctgtacaacaa
agactcaaactttataacaaagtacctccaaatggtctggttgtatactgtggaacaatt
gtaacagaagaaggaaaggaaaagaaagtcaacattgactttgaacctttcaaaccaatt
aatacgtcattgtatttgtgtgacaacaaattccatacagaggctcttacagcactactt
tcagatgatagcaagtttggattcattgtaatagatggtagtggtgcactttttggcaca
ctccaaggaaacacaagagaagtcctgcacaaattcactgtggatctcccaaagaaacac
ggtagaggaggtcagtcagccttgcgttttgcccgtttaagaatggaaaagcgacataac
tatgttcggaaagtagcagagactgctgtgcagctgtttatttctggggacaaagtgaat
gtggctggtctagttttagctggatccgctgactttaaaactgaactaagtcaatctgat
atgtttgatcagaggttacaatcaaaagttttaaaattagttgatatatcctatggtggt
gaaaatggattcaaccaagctattgagttatctactgaagtcctctccaacgtgaaattc
attcaagagaagaaattaataggacgatactttgatgaaatcagccaggacacgggcaag
tactgttttggcgttgaagatacactaaaggctttggaaatgggagctgtagaaattcta
atagtctatgaaaatctggatataatgagatatgttcttcattgccaaggcacagaagag
gagaaaattctctatctaactccagagcaagaaaaggataaatctcatttcacagacaaa
gagaccggacaggaacatgagcttatcgagagcatgcccctgttggaatggtttgctaac
aactataaaaaatttggagctacgttggaaattgtcacagataaatcacaagaagggtct
cagtttgtgaaaggatttggtggaattggaggtatcttgcggtaccgagtagatttccag
ggaatggaataccaaggaggagacgatgaattttttgaccttgatgactactag

DBGET integrated database retrieval system