KEGG   Homo sapiens (human): 2114
Entry
2114              CDS       T01001                                 

Gene name
ETS2, ETS2IT1
Definition
(RefSeq) ETS proto-oncogene 2, transcription factor
  KO
K21932  C-ets-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2114 (ETS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2114 (ETS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2114 (ETS2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2114 (ETS2)
SSDB
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Other DBs
NCBI-GeneID: 2114
NCBI-ProteinID: NP_005230
OMIM: 164740
HGNC: 3489
Ensembl: ENSG00000157557
Vega: OTTHUMG00000090769
Pharos: P15036(Tbio)
UniProt: P15036
Structure
PDB: 
4MHV 4BQA

Position
21q22.2
AA seq 469 aa
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgaatgatttcggaatcaagaatatggaccaggtagcccctgtggctaacagttacaga
gggacactcaagcgccagccagcctttgacacctttgatgggtccctgtttgctgttttt
ccttctctaaatgaagagcaaacactgcaagaagtgccaacaggcttggattccatttct
catgactccgccaactgtgaattgcctttgttaaccccgtgcagcaaggctgtgatgagt
caagccttaaaagctaccttcagtggcttcaaaaaggaacagcggcgcctgggcattcca
aagaacccctggctgtggagtgagcaacaggtatgccagtggcttctctgggccaccaat
gagttcagtctggtgaacgtgaatctgcagaggttcggcatgaatggccagatgctgtgt
aaccttggcaaggaacgctttctggagctggcacctgactttgtgggtgacattctctgg
gaacatctggagcaaatgatcaaagaaaaccaagaaaagacagaagatcaatatgaagaa
aattcacacctcacctccgttcctcattggattaacagcaatacattaggttttggcaca
gagcaggcgccctatggaatgcagacacagaattaccccaaaggcggcctcctggacagc
atgtgtccggcctccacacccagcgtactcagctctgagcaggagtttcagatgttcccc
aagtctcggctcagctccgtcagcgtcacctactgctctgtcagtcaggacttcccaggc
agcaacttgaatttgctcaccaacaattctgggactcccaaagaccacgactcccctgag
aacggtgcggacagcttcgagagctcagactccctcctccagtcctggaacagccagtcg
tccttgctggatgtgcaacgggttccttccttcgagagcttcgaagatgactgcagccag
tctctctgcctcaataagccaaccatgtctttcaaggattacatccaagagaggagtgac
ccagtggagcaaggcaaaccagttatacctgcagctgtgctggccggcttcacaggaagt
ggacctattcagctgtggcagtttctcctggagctgctatcagacaaatcctgccagtca
ttcatcagctggactggagacggatgggagtttaagctcgccgaccccgatgaggtggcc
cgccggtggggaaagaggaaaaataagcccaagatgaactacgagaagctgagccggggc
ttacgctactattacgacaagaacatcatccacaagacgtcggggaagcgctacgtgtac
cgcttcgtgtgcgacctccagaacttgctggggttcacgcccgaggaactgcacgccatc
ctgggcgtccagcccgacacggaggactga

DBGET integrated database retrieval system