KEGG   Homo sapiens (human): 2116Help
Entry
2116              CDS       T01001                                 

Gene name
ETV2, ER71, ETSRP71
Definition
(RefSeq) ETS variant 2
  KO
K09432  ETS translocation variant 2
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2116 (ETV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 2116
NCBI-ProteinID: NP_055024
OMIM: 609358
HGNC: 3491
Ensembl: ENSG00000105672
Vega: OTTHUMG00000150545
Pharos: O00321(Tbio)
UniProt: O00321
Position
19q13.12
AA seq 342 aa AA seqDB search
MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASF
PQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIP
AAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTI
SWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGP
IQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLR
YYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggacctgtggaactgggatgaggcatccccacaggaagtgcctccagggaacaagctg
gcagggcttgaaggagccaaattaggcttctgtttccctgatctggcactccaaggggac
acgccgacagcgacagcagagacatgctggaaaggtacaagctcatccctggcaagcttc
ccacagctggactggggctccgcgttactgcacccagaagttccatggggggcggagccc
gactctcaggctcttccgtggtccggggactggacagacatggcgtgcacagcctgggac
tcttggagcggcgcctcgcagaccctgggccccgcccctctcggcccgggccccatcccc
gccgccggctccgaaggcgccgcgggccagaactgcgtccccgtggcgggagaggccacc
tcgtggtcgcgcgcccaggccgccgggagcaacaccagctgggactgttctgtggggccc
gacggcgatacctactggggcagtggcctgggcggggagccgcgcacggactgtaccatt
tcgtggggcgggcccgcgggcccggactgtaccacctcctggaacccggggctgcatgcg
ggtggcaccacctctttgaagcggtaccagagctcagctctcaccgtttgctccgaaccg
agcccgcagtcggaccgtgccagtttggctcgatgccccaaaactaaccaccgaggtccc
attcagctgtggcagttcctcctggagctgctccacgacggggcgcgtagcagctgcatc
cgttggactggcaacagccgcgagttccagctgtgcgaccccaaagaggtggctcggctg
tggggcgagcgcaagagaaagccgggcatgaattacgagaagctgagccggggccttcgc
tactactatcgccgcgacatcgtgcgcaagagcggggggcgaaagtacacgtaccgcttc
gggggccgcgtgcccagcctagcctatccggactgtgcgggaggcggacggggagcagag
acacaataa

DBGET integrated database retrieval system