KEGG   Homo sapiens (human): 2120
Entry
2120              CDS       T01001                                 
Symbol
ETV6, TEL, TEL/ABL, THC5
Name
(RefSeq) ETS variant transcription factor 6
  KO
K03211  ETS translocation variant 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00003  Acute myeloid leukemia
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2120 (ETV6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2120 (ETV6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2120 (ETV6)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 HSF_DNA-bind
Other DBs
NCBI-GeneID: 2120
NCBI-ProteinID: NP_001978
OMIM: 600618
HGNC: 3495
Ensembl: ENSG00000139083
Pharos: P41212(Tbio)
UniProt: P41212 A0A0S2Z3C9
Structure
Position
12:11649674..11895377
AA seq 452 aa
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY
WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH
RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM
ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW
EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca
gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagcg
ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac
tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgagttttctttaagg
ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag
gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt
ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata
cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg
acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac
cgctccaggtcacctatcacgacaaatcaccggccttctcctgaccccgagcagcggccc
ctccggtcccccctggacaacatgatccgccgcctctccccggctgagagagctcaggga
cccaggccgcaccaggagaacaaccaccaggagtcctaccctctgtcagtgtctcccatg
gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag
gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac
ccccggcactccgtggatttcaaacagtccaggctctccgaggacgggctgcatagggaa
gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc
tctgtctccccgcctgaagagcacgccatgcccattgggagaatagcagactgtagactg
ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg
gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg
ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac
tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg
aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag
gagctggatgaacaaatataccaagaagatgaatgctga

DBGET integrated database retrieval system