KEGG   Homo sapiens (human): 2120
Entry
2120              CDS       T01001                                 

Symbol
ETV6, TEL, TEL/ABL, THC5
Name
(RefSeq) ETS variant transcription factor 6
  KO
K03211  ETS translocation variant 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2120 (ETV6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2120 (ETV6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2120 (ETV6)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 HSF_DNA-bind
Other DBs
NCBI-GeneID: 2120
NCBI-ProteinID: NP_001978
OMIM: 600618
HGNC: 3495
Ensembl: ENSG00000139083
Vega: OTTHUMG00000168538
Pharos: P41212(Tbio)
UniProt: P41212 A0A0S2Z3C9
Structure
PDB: 
1JI7 1LKY 2DAO

Position
12p13.2
AA seq 452 aa
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIY
WSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHI
LKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLH
RSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPM
ENNHCPASSESHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRW
EDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFM
KTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgtctgagactcctgctcagtgtagcattaagcaggaacgaatttcatatacacctcca
gagagcccagtgccgagttacgcttcctcgacgccacttcatgttccagtgcctcgagcg
ctcaggatggaggaagactcgatccgcctgcctgcgcacctgcgcttgcagccaatttac
tggagcagggatgacgtagcccagtggctcaagtgggctgaaaatgagttttctttaagg
ccaattgacagcaacacgtttgaaatgaatggcaaagctctcctgctgctgaccaaagag
gactttcgctatcgatctcctcattcaggtgatgtgctctatgaactccttcagcatatt
ctgaagcagaggaaacctcggattcttttttcaccattcttccaccctggaaactctata
cacacacagccggaggtcatactgcatcagaaccatgaagaagataactgtgtccagagg
acccccaggccatccgtggataatgtgcaccataaccctcccaccattgaactgttgcac
cgctccaggtcacctatcacgacaaatcaccggccttctcctgaccccgagcagcggccc
ctccggtcccccctggacaacatgatccgccgcctctccccggctgagagagctcaggga
cccaggccgcaccaggagaacaaccaccaggagtcctaccctctgtcagtgtctcccatg
gagaataatcactgcccagcgtcctccgagtcccacccgaagccatccagcccccggcag
gagagcacacgcgtgatccagctgatgcccagccccatcatgcaccctctgatcctgaac
ccccggcactccgtggatttcaaacagtccaggctctccgaggacgggctgcatagggaa
gggaagcccatcaacctctctcatcgggaagacctggcttacatgaaccacatcatggtc
tctgtctccccgcctgaagagcacgccatgcccattgggagaatagcagactgtagactg
ctttgggattacgtctatcagttgctttctgacagccggtacgaaaacttcatccgatgg
gaggacaaagaatccaaaatattccggatagtggatcccaacggactggctcgactgtgg
ggaaaccataagaacagaacaaacatgacctatgagaaaatgtccagagccctgcgccac
tactacaaactaaacattatcaggaaggagccaggacaaaggcttttgttcaggtttatg
aaaaccccagatgaaatcatgagtggccgaacagaccgtctggagcacctagagtcccag
gagctggatgaacaaatataccaagaagatgaatgctga

KEGG   Homo sapiens (human): 51513
Entry
51513             CDS       T01001                                 

Symbol
ETV7, TEL-2, TEL2, TELB
Name
(RefSeq) ETS variant transcription factor 7
  KO
K03211  ETS translocation variant 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    51513 (ETV7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51513 (ETV7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    51513 (ETV7)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 51513
NCBI-ProteinID: NP_057219
OMIM: 605255
HGNC: 18160
Ensembl: ENSG00000010030
Vega: OTTHUMG00000014594
Pharos: Q9Y603(Tbio)
UniProt: Q9Y603
Position
6p21.31
AA seq 341 aa
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVL
HWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
VCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLA
RWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYE
PYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKL
LFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcaggagggagaattggctatttctcctataagccctgtggcagccatgcctccccta
ggcacccacgtgcaagccagatgtgaagctcaaattaacctgctgggtgaaggggggatc
tgcaagctgccaggaagactccgcatccagcccgcactgtggagcagggaggacgtgctg
cactggctgcgctgggcagagcaggagtactctctgccatgcaccgcggagcacgggttc
gagatgaacggacgcgccctctgcatcctcaccaaggacgacttccggcaccgtgcgccc
agctcaggtgacgtcctgtatgagctgctccagtacatcaagacccagcggcgagccctg
gtgtgtgggcccttttttggagggatcttcaggctgaagacgcccacccagcactctcca
gtccccccggaagaggtgactggcccctctcagatggacacccgaaggggccacctgctg
cagccaccagacccagggcttaccagcaacttcggccacctggatgaccctggcctggca
aggtggacccctggcaaggaggagtccctcaacttatgtcactgtgcagagctcggctgc
aggacccagggggtctgttccttccccgcgatgccgcaggcccccattgacggcaggatc
gctgactgccgcctgctgtgggattacgtgtatcagctgctccttgatacccgatatgag
ccctacatcaagtgggaagacaaggacgccaagatcttccgagttgtggatccaaatggg
ctcgccagactctggggaaatcacaagaaccgggtgaacatgacctacgagaagatgtct
cgtgccctgcgccactattataagcttaatatcattaagaaggaaccggggcagaaactc
ctgttcagatttctaaagactccgggaaagatggtccaggacaagcacagccacctggag
ccgctggagagccaggagcaggacagaatagagttcaaggacaagaggccagaaatctct
ccgtga

DBGET integrated database retrieval system