KEGG   Homo sapiens (human): 2122Help
Entry
2122              CDS       T01001                                 

Gene name
MECOM, AML1-EVI-1, EVI1, KMT8E, MDS1, MDS1-EVI1, PRDM3, RUSAT2
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05200  Pathways in cancer
hsa05220  Chronic myeloid leukemia
Network
N00107  EVI-1 overexpression to TGF-beta signaling pathway
Disease
H00004  Chronic myeloid leukemia (CML)
H00867  Radioulnar synostosis with amegakaryocytic thrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2122 (MECOM)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2122 (MECOM)
   05220 Chronic myeloid leukemia
    2122 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2122 (MECOM)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    2122 (MECOM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 Zn-ribbon_8 zf-C2H2_11 zf-met PyrI_C SET
Motif
Other DBs
NCBI-GeneID: 2122
NCBI-ProteinID: NP_004982
OMIM: 165215
HGNC: 3498
Ensembl: ENSG00000085276
Vega: OTTHUMG00000158596
Pharos: Q03112(Tbio)
UniProt: Q03112
Position
3q26.2
AA seq 1239 aa AA seqDB search
MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDP
SYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEERQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLQEIHTIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASINNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPQSPGEVKKLQKGSSESPFDLTTKRKDEKPLTPVPSKPPVTPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGGKKGSNVESRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEE
VEDEVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEY
KSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMM
LSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaaataatgagtgtgtatatggcaac
taccctgaaatacctttggaagaaatgccagatgcagatggagtagccagcactccctcc
ctcaatattcaagagccatgctctcctgccacatccagtgaagcattcactccaaaggag
ggttctccttacaaagcccccatctacatccctgatgatatccccattcctgctgagttt
gaacttcgagagtcaaatatgcctggggcaggactaggaatatggaccaaaaggaagatc
gaagtaggtgaaaagtttgggccttatgtgggagagcagaggtcaaacctgaaagacccc
agttatggatgggagatcttagacgaattttacaatgtgaagttctgcatagatgccagt
caaccagatgttggaagctggctcaagtacattagattcgctggctgttatgatcagcac
aaccttgttgcatgccagataaatgatcagatattctatagagtagttgcagacattgcg
ccgggagaggagcttctgctgttcatgaagagcgaagactatccccatgaaactatggcg
ccggatatccacgaagaacggcaatatcgctgcgaagactgtgaccagctctttgaatct
aaggctgaactagcagatcaccaaaagtttccatgcagtactcctcactcagcattttca
atggttgaagaggactttcagcaaaaactcgaaagcgagaatgatctccaagagatacac
acgatccaggagtgtaaggaatgtgaccaagtttttcctgatttgcaaagcctggagaaa
cacatgctgtcacatactgaagagagggaatacaagtgtgatcagtgtcccaaggcattt
aactggaagtccaatttaattcgccaccagatgtcacatgacagtggaaagcactatgaa
tgtgaaaactgtgccaaggttttcacggaccctagcaaccttcagcggcacattcgctct
cagcatgtcggtgcccgggcccatgcatgcccggagtgtggcaaaacgtttgccacttcg
tcgggcctcaaacaacacaagcacatccacagcagtgtgaagccctttatctgtgaggtc
tgccataaatcctatactcagttttcaaacctttgccgtcataagcgcatgcatgctgat
tgcagaacccaaatcaagtgcaaagactgtggacaaatgttcagcactacgtcttcctta
aataaacacaggaggttttgtgagggcaagaaccattttgcggcaggtggattttttggc
caaggcatttcacttcctggaaccccagctatggataaaacgtccatggttaatatgagt
catgccaacccgggccttgctgactattttggcgccaataggcatcctgctggtcttacc
tttccaacagctcctggattttcttttagcttccctggtctgtttccttccggcttgtac
cacaggcctcctttgatacctgctagttctcctgttaaaggactatcaagtactgaacag
acaaacaaaagtcaaagtcccctcatgacacatcctcagatactgccagctacacaggat
attttgaaggcactatctaaacacccatctgtaggggacaataagccagtggagctccag
cccgagaggtcctctgaagagaggccctttgagaaaatcagtgaccagtcagagagtagt
gaccttgatgatgtcagtacaccaagtggcagtgacctggaaacaacctcgggctctgat
ctggaaagtgacattgaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaa
gacaaagtaagccctcttcagaatctggcttcaataaataataagaaagaatacagcaat
cattccattttctcaccatctttagaggagcagactgcggtgtcaggagctgtgaatgat
tctataaaggctattgcttctattgctgaaaaatactttggttcaacaggactggtgggg
ctgcaagacaaaaaagttggagctttaccttacccttccatgtttcccctcccatttttt
ccagcattctctcaatcaatgtacccatttcctgatagagacttgagatcgttacctttg
aaaatggaaccccaatcaccaggtgaagtaaagaaactgcagaagggcagctctgagtcc
ccctttgatctcaccactaagcgaaaggatgagaagcccttgactccagtcccctccaag
cctccagtgacacctgccacaagccaagaccagcccctggatctaagtatgggcagtagg
agtagagccagtgggacaaagctgactgagcctcgaaaaaaccacgtgtttgggggaaaa
aaaggaagcaacgtcgaatcaagacctgcttcagatggttccttgcagcatgcaagaccc
actcctttctttatggaccctatttacagagtagagaaaagaaaactaactgacccactt
gaagctttaaaagagaaatacttgaggccttctccaggattcttgtttcacccacaattc
caactgcctgatcagagaacttggatgtcagctattgaaaacatggcagaaaagctagag
agcttcagtgccctgaaacctgaggccagtgagctcttacagtcagtgccctctatgttc
aacttcagggcgcctcccaatgccctgccagagaaccttctgcggaagggaaaggagcgc
tatacctgcagatactgtggcaagatttttccaaggtctgcaaacctaacacggcacttg
agaacccacacaggagagcagccttacagatgcaaatactgtgacagatcatttagcata
tcttctaacttgcaaaggcatgttcgcaacatccacaataaagagaagccatttaagtgt
cacttatgtgataggtgttttggtcaacaaaccaatttagacagacacctaaagaaacat
gagaatgggaacatgtccggtacagcaacatcgtcgcctcattctgaactggaaagtaca
ggtgcgattctggatgacaaagaagatgcttacttcacagaaattcgaaatttcattggg
aacagcaaccatggcagccaatctcccaggaatgtggaggagagaatgaatggcagtcat
tttaaagatgaaaaggctttggtgaccagtcaaaattcagacttgctggatgatgaagaa
gttgaagatgaggtgttgttagatgaggaggatgaagacaatgatattactggaaaaaca
ggaaaggaaccagtgacaagtaatttacatgaaggaaaccctgaggatgactatgaagaa
accagtgccctggagatgagttgcaagacatccccagtgaggtataaagaggaagaatat
aaaagtggactttctgctctagatcatataaggcacttcacagatagcctcaaaatgagg
aaaatggaagataatcaatattctgaagctgagctgtcttcttttagtacttcccatgtg
ccagaggaacttaagcagccgttacacagaaagtccaaatcgcaggcatatgctatgatg
ctgtcactgtctgacaaggagtccctccattctacatcccacagttcttccaacgtgtgg
cacagtatggccagggctgcggcggaatccagtgctatccagtccataagccacgtatga

DBGET integrated database retrieval system