KEGG   Homo sapiens (human): 214Help
Entry
214               CDS       T01001                                 

Gene name
ALCAM, CD166, MEMD
Definition
(RefSeq) activated leukocyte cell adhesion molecule
  KO
K06547  activated leukocyte cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    214 (ALCAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    214 (ALCAM)
   04090 CD molecules [BR:hsa04090]
    214 (ALCAM)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  ALCAM
   214 (ALCAM)
CD molecules [BR:hsa04090]
 Proteins
  214 (ALCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig C1-set V-set CD34_antigen Amnionless PepSY_TM FixQ
Motif
Other DBs
NCBI-GeneID: 214
NCBI-ProteinID: NP_001618
OMIM: 601662
HGNC: 400
Ensembl: ENSG00000170017
Vega: OTTHUMG00000159192
Pharos: Q13740(Tbio)
UniProt: Q13740
Structure
PDB: 

Position
3q13.11
AA seq 583 aa AA seqDB search
MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDN
VFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPL
EGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVF
DIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaagggggccagttcctgccgtctgctcttctgcctcttgatctccgccacc
gtcttcaggccaggccttggatggtatactgtaaattcagcatatggagataccattatc
ataccttgccgacttgacgtacctcagaatctcatgtttggcaaatggaaatatgaaaag
cccgatggctccccagtatttattgccttcagatcctctacaaagaaaagtgtgcagtac
gacgatgtaccagaatacaaagacagattgaacctctcagaaaactacactttgtctatc
agtaatgcaaggatcagtgatgaaaagagatttgtgtgcatgctagtaactgaggacaac
gtgtttgaggcacctacaatagtcaaggtgttcaagcaaccatctaaacctgaaattgta
agcaaagcactgtttctcgaaacagagcagctaaaaaagttgggtgactgcatttcagaa
gacagttatccagatggcaatatcacatggtacaggaatggaaaagtgctacatcccctt
gaaggagcggtggtcataatttttaaaaaggaaatggacccagtgactcagctctatacc
atgacttccaccctggagtacaagacaaccaaggctgacatacaaatgccattcacctgc
tcggtgacatattatggaccatctggccagaaaacaattcattctgaacaggcagtattt
gatatttactatcctacagagcaggtgacaatacaagtgctgccaccaaaaaatgccatc
aaagaaggggataacatcactcttaaatgcttagggaatggcaaccctcccccagaggaa
tttttgttttacttaccaggacagcccgaaggaataagaagctcaaatacttacacactg
acggatgtgaggcgcaatgcaacaggagactacaagtgttccctgatagacaaaaaaagc
atgattgcttcaacagccatcacagttcactatttggatttgtccttaaacccaagtgga
gaagtgactagacagattggtgatgccctacccgtgtcatgcacaatatctgctagcagg
aatgcaactgtggtatggatgaaagataacatcaggcttcgatctagcccgtcattttct
agtcttcattatcaggatgctggaaactatgtctgcgaaactgctctgcaggaggttgaa
ggactaaagaaaagagagtcattgactctcattgtagaaggcaaacctcaaataaaaatg
acaaagaaaactgatcccagtggactatctaaaacaataatctgccatgtggaaggtttt
ccaaagccagccattcaatggacaattactggcagtggaagcgtcataaaccaaacagag
gaatctccttatattaatggcaggtattatagtaaaattatcatttcccctgaagagaat
gttacattaacttgcacagcagaaaaccaactggagagaacagtaaactccttgaatgtc
tctgctataagtattccagaacacgatgaggcagacgagataagtgatgaaaacagagaa
aaggtgaatgaccaggcaaaactaattgtgggaatcgttgttggtctcctccttgctgcc
cttgttgctggtgtcgtctactggctgtacatgaagaagtcaaagactgcatcaaaacat
gtaaacaaggacctcggtaatatggaagaaaacaaaaagttagaagaaaacaatcacaaa
actgaagcctaa

DBGET integrated database retrieval system