KEGG   Homo sapiens (human): 2146Help
Entry
2146              CDS       T01001                                 

Gene name
EZH2, ENX-1, ENX1, EZH2b, KMT6, KMT6A, WVS, WVS2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00310  Lysine degradation
hsa05206  MicroRNAs in cancer
Disease
H01613  Follicular lymphoma
H01751  Weaver syndrome
Drug target
Tazemetostat (DG03020): D11444 D11485
Valemetostat: D11551
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    2146 (EZH2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    2146 (EZH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    2146 (EZH2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     2146 (EZH2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     2146 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     2146 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRC2_HTH_1 SET EZH2_WD-Binding preSET_CXC
Motif
Other DBs
NCBI-GeneID: 2146
NCBI-ProteinID: NP_001190176
OMIM: 601573
HGNC: 3527
Ensembl: ENSG00000106462
Vega: OTTHUMG00000158973
Pharos: Q15910(Tchem)
UniProt: Q15910
Structure
PDB: 

Position
7q36.1
AA seq 746 aa AA seqDB search
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggccagactgggaagaaatctgagaagggaccagtttgttggcggaagcgtgtaaaa
tcagagtacatgcgactgagacagctcaagaggttcagacgagctgatgaagtaaagagt
atgtttagttccaatcgtcagaaaattttggaaagaacggaaatcttaaaccaagaatgg
aaacagcgaaggatacagcctgtgcacatcctgacttctgtgagctcattgcgcgggact
agggagtgttcggtgaccagtgacttggattttccaacacaagtcatcccattaaagact
ctgaatgcagttgcttcagtacccataatgtattcttggtctcccctacagcagaatttt
atggtggaagatgaaactgttttacataacattccttatatgggagatgaagttttagat
caggatggtactttcattgaagaactaataaaaaattatgatgggaaagtacacggggat
agagaatgtgggtttataaatgatgaaatttttgtggagttggtgaatgcccttggtcaa
tataatgatgatgacgatgatgatgatggagacgatcctgaagaaagagaagaaaagcag
aaagatctggaggatcaccgagatgataaagaaagccgcccacctcggaaatttccttct
gataaaatttttgaagccatttcctcaatgtttccagataagggcacagcagaagaacta
aaggaaaaatataaagaactcaccgaacagcagctcccaggcgcacttcctcctgaatgt
acccccaacatagatggaccaaatgctaaatctgttcagagagagcaaagcttacactcc
tttcatacgcttttctgtaggcgatgttttaaatatgactgcttcctacatccttttcat
gcaacacccaacacttataagcggaagaacacagaaacagctctagacaacaaaccttgt
ggaccacagtgttaccagcatttggagggagcaaaggagtttgctgctgctctcaccgct
gagcggataaagaccccaccaaaacgtccaggaggccgcagaagaggacggcttcccaat
aacagtagcaggcccagcacccccaccattaatgtgctggaatcaaaggatacagacagt
gatagggaagcagggactgaaacggggggagagaacaatgataaagaagaagaagagaag
aaagatgaaacttcgagctcctctgaagcaaattctcggtgtcaaacaccaataaagatg
aagccaaatattgaacctcctgagaatgtggagtggagtggtgctgaagcctcaatgttt
agagtcctcattggcacttactatgacaatttctgtgccattgctaggttaattgggacc
aaaacatgtagacaggtgtatgagtttagagtcaaagaatctagcatcatagctccagct
cccgctgaggatgtggatactcctccaaggaaaaagaagaggaaacaccggttgtgggct
gcacactgcagaaagatacagctgaaaaaggacggctcctctaaccatgtttacaactat
caaccctgtgatcatccacggcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcaatgtagttcagagtgtcaaaaccgctttccgggatgc
cgctgcaaagcacagtgcaacaccaagcagtgcccgtgctacctggctgtccgagagtgt
gaccctgacctctgtcttacttgtggagccgctgaccattgggacagtaaaaatgtgtcc
tgcaagaactgcagtattcagcggggctccaaaaagcatctattgctggcaccatctgac
gtggcaggctgggggatttttatcaaagatcctgtgcagaaaaatgaattcatctcagaa
tactgtggagagattatttctcaagatgaagctgacagaagagggaaagtgtatgataaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggtaacaaaattcgttttgcaaatcattcggtaaatccaaactgctatgcaaaagttatg
atggttaacggtgatcacaggataggtatttttgccaagagagccatccagactggcgaa
gagctgttttttgattacagatacagccaggctgatgccctgaagtatgtcggcatcgaa
agagaaatggaaatcccttga

DBGET integrated database retrieval system