KEGG   Homo sapiens (human): 2147
Entry
2147              CDS       T01001                                 
Symbol
F2, PT, RPRGL2, THPH1
Name
(RefSeq) coagulation factor II, thrombin
  KO
K01313  coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06514  Coagulation cascade
  Element
N01315  Lectin pathway of coagulation cascade, prothrombin to thrombin
N01512  Common pathway of coagulation cascade, prothrombin activation
Disease
H00223  Inherited thrombophilia
H01254  Congenital prothrombin deficiency
Drug target
Argatroban (DG00163): D00181<JP/US>
Bivalirudin: D03136
Bivalirudin (DG02963): D11280<US>
Dabigatran (DG00164): D09707
Dabigatran etexilate (DG00164): D07082<JP/US> D07144
Desirudin: D03692
Efegatran sulfate: D03722
Lepirudin: D06880
Melagatran: D07143
Napsagatran: D03728
Thrombomodulin alfa: D06410<JP>
Ximelagatran: D01981
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2147 (F2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2147 (F2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2147 (F2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2147 (F2)
   04611 Platelet activation
    2147 (F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2147 (F2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    2147 (F2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2147 (F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2147 (F2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2147 (F2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2147 (F2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     2147 (F2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2147 (F2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2147 (F2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   2147 (F2)
SSDB
Motif
Pfam: Trypsin Kringle Thrombin_light Gla DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 2147
NCBI-ProteinID: NP_000497
OMIM: 176930
HGNC: 3535
Ensembl: ENSG00000180210
Pharos: P00734(Tclin)
CPD: C00752
UniProt: P00734
Structure
Position
11:46719213..46739506
AA seq 622 aa
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcgcacgtccgaggcttgcagctgcctggctgcctggccctggctgccctgtgtagc
cttgtgcacagccagcatgtgttcctggctcctcagcaagcacggtcgctgctccagcgg
gtccggcgagccaacaccttcttggaggaggtgcgcaagggcaacctggagcgagagtgc
gtggaggagacgtgcagctacgaggaggccttcgaggctctggagtcctccacggctacg
gatgtgttctgggccaagtacacagcttgtgagacagcgaggacgcctcgagataagctt
gctgcatgtctggaaggtaactgtgctgagggtctgggtacgaactaccgagggcatgtg
aacatcacccggtcaggcattgagtgccagctatggaggagtcgctacccacataagcct
gaaatcaactccactacccatcctggggccgacctacaggagaatttctgccgcaacccc
gacagcagcaccacgggaccctggtgctacactacagaccccaccgtgaggaggcaggaa
tgcagcatccctgtctgtggccaggatcaagtcactgtagcgatgactccacgctccgaa
ggctccagtgtgaatctgtcacctccattggagcagtgtgtccctgatcgggggcagcag
taccaggggcgcctggcggtgaccacacatgggctcccctgcctggcctgggccagcgca
caggccaaggccctgagcaagcaccaggacttcaactcagctgtgcagctggtggagaac
ttctgccgcaacccagacggggatgaggagggcgtgtggtgctatgtggccgggaagcct
ggcgactttgggtactgcgacctcaactattgtgaggaggccgtggaggaggagacagga
gatgggctggatgaggactcagacagggccatcgaagggcgtaccgccaccagtgagtac
cagactttcttcaatccgaggacctttggctcgggagaggcagactgtgggctgcgacct
ctgttcgagaagaagtcgctggaggacaaaaccgaaagagagctcctggaatcctacatc
gacgggcgcattgtggagggctcggatgcagagatcggcatgtcaccttggcaggtgatg
cttttccggaagagtccccaggagctgctgtgtggggccagcctcatcagtgaccgctgg
gtcctcaccgccgcccactgcctcctgtacccgccctgggacaagaacttcaccgagaat
gaccttctggtgcgcattggcaagcactcccgcaccaggtacgagcgaaacattgaaaag
atatccatgttggaaaagatctacatccaccccaggtacaactggcgggagaacctggac
cgggacattgccctgatgaagctgaagaagcctgttgccttcagtgactacattcaccct
gtgtgtctgcccgacagggagacggcagccagcttgctccaggctggatacaaggggcgg
gtgacaggctggggcaacctgaaggagacgtggacagccaacgttggtaaggggcagccc
agtgtcctgcaggtggtgaacctgcccattgtggagcggccggtctgcaaggactccacc
cggatccgcatcactgacaacatgttctgtgctggttacaagcctgatgaagggaaacga
ggggatgcctgtgaaggtgacagtgggggaccctttgtcatgaagagcccctttaacaac
cgctggtatcaaatgggcatcgtctcatggggtgaaggctgtgaccgggatgggaaatat
ggcttctacacacatgtgttccgcctgaagaagtggatacagaaggtcattgatcagttt
ggagagtag

DBGET integrated database retrieval system