KEGG   Homo sapiens (human): 2149
Entry
2149              CDS       T01001                                 

Symbol
F2R, CF2R, HTR, PAR-1, PAR1, TR
Name
(RefSeq) coagulation factor II thrombin receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Drug target
Atopaxar (DG01348): D09866 D09867
Vorapaxar (DG01349): D09765 D09766<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2149 (F2R)
   04020 Calcium signaling pathway
    2149 (F2R)
   04072 Phospholipase D signaling pathway
    2149 (F2R)
   04024 cAMP signaling pathway
    2149 (F2R)
   04151 PI3K-Akt signaling pathway
    2149 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2149 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2149 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2149 (F2R)
   04611 Platelet activation
    2149 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2149 (F2R)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2149 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2149 (F2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2149 (F2R)
SSDB
Motif
Pfam: 7tm_1 DUF4064
Other DBs
NCBI-GeneID: 2149
NCBI-ProteinID: NP_001983
OMIM: 187930
HGNC: 3537
Ensembl: ENSG00000181104
Vega: OTTHUMG00000131299
Pharos: P25116(Tclin)
UniProt: P25116 A0A024RAP7
Structure
PDB: 

Position
5q13.3
AA seq 425 aa
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccatcaataaaagcagtcctctt
caaaaacaacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacactctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

KEGG   Homo sapiens (human): 929
Entry
929               CDS       T01001                                 

Symbol
CD14
Name
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04145  Phagosome
hsa04620  Toll-like receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04936  Alcoholic liver disease
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05417  Lipid and atherosclerosis
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Disease
H00079  Asthma
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    929 (CD14)
   04064 NF-kappa B signaling pathway
    929 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    929 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    929 (CD14)
   04620 Toll-like receptor signaling pathway
    929 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    929 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    929 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    929 (CD14)
   05131 Shigellosis
    929 (CD14)
   05133 Pertussis
    929 (CD14)
   05134 Legionellosis
    929 (CD14)
   05152 Tuberculosis
    929 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    929 (CD14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    929 (CD14)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    929 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    929 (CD14)
   04090 CD molecules [BR:hsa04090]
    929 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    929 (CD14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   929 (CD14)
CD molecules [BR:hsa04090]
 Proteins
  929 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  929 (CD14)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_6
Other DBs
NCBI-GeneID: 929
NCBI-ProteinID: NP_000582
OMIM: 158120
HGNC: 1628
Ensembl: ENSG00000170458
Vega: OTTHUMG00000129507
Pharos: P08571(Tbio)
UniProt: P08571
Structure
PDB: 
4GLP

Position
5q31.3
AA seq 375 aa
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccat
gccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccaca
ggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttgg
ctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaag
ttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcaga
gtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccac
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

DBGET integrated database retrieval system