KEGG   Homo sapiens (human): 2158Help
Entry
2158              CDS       T01001                                 

Gene name
F9, F9_p22, FIX, HEMB, P19, PTC, THPH8
Definition
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00219  Hemophilia
H00223  Inherited thrombophilia
Drug target
Emicizumab: D10821
Pegnivacogin (DG01399): D10150 D10484
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2158 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2158 (F9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     2158 (F9)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2158 (F9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition EGF DUF1986 Trypsin_2 cEGF hEGF
Motif
Other DBs
NCBI-GeneID: 2158
NCBI-ProteinID: NP_000124
OMIM: 300746
HGNC: 3551
Ensembl: ENSG00000101981
Vega: OTTHUMG00000022536
Pharos: P00740(Tchem)
UniProt: P00740
Structure
PDB: 

Position
Xq27.1
AA seq 461 aa AA seqDB search
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
HKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgtgaacatgatcatggcagaatcaccaggcctcatcaccatctgcctttta
ggatatctactcagtgctgaatgtacagtttttcttgatcatgaaaacgccaacaaaatt
ctgaatcggccaaagaggtataattcaggtaaattggaagagtttgttcaagggaacctt
gagagagaatgtatggaagaaaagtgtagttttgaagaagcacgagaagtttttgaaaac
actgaaagaacaactgaattttggaagcagtatgttgatggagatcagtgtgagtccaat
ccatgtttaaatggcggcagttgcaaggatgacattaattcctatgaatgttggtgtccc
tttggatttgaaggaaagaactgtgaattagatgtaacatgtaacattaagaatggcaga
tgcgagcagttttgtaaaaatagtgctgataacaaggtggtttgctcctgtactgaggga
tatcgacttgcagaaaaccagaagtcctgtgaaccagcagtgccatttccatgtggaaga
gtttctgtttcacaaacttctaagctcacccgtgctgagactgtttttcctgatgtggac
tatgtaaattctactgaagctgaaaccattttggataacatcactcaaagcacccaatca
tttaatgacttcactcgggttgttggtggagaagatgccaaaccaggtcaattcccttgg
caggttgttttgaatggtaaagttgatgcattctgtggaggctctatcgttaatgaaaaa
tggattgtaactgctgcccactgtgttgaaactggtgttaaaattacagttgtcgcaggt
gaacataatattgaggagacagaacatacagagcaaaagcgaaatgtgattcgaattatt
cctcaccacaactacaatgcagctattaataagtacaaccatgacattgcccttctggaa
ctggacgaacccttagtgctaaacagctacgttacacctatttgcattgctgacaaggaa
tacacgaacatcttcctcaaatttggatctggctatgtaagtggctggggaagagtcttc
cacaaagggagatcagctttagttcttcagtaccttagagttccacttgttgaccgagcc
acatgtcttcgatctacaaagttcaccatctataacaacatgttctgtgctggcttccat
gaaggaggtagagattcatgtcaaggagatagtgggggaccccatgttactgaagtggaa
gggaccagtttcttaactggaattattagctggggtgaagagtgtgcaatgaaaggcaaa
tatggaatatataccaaggtatcccggtatgtcaactggattaaggaaaaaacaaagctc
acttaa

DBGET integrated database retrieval system