KEGG   Homo sapiens (human): 2158
Entry
2158              CDS       T01001                                 
Symbol
F9, F9_p22, FIX, HEMB, P19, PTC, THPH8
Name
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01508  Intrinsic pathway of coagulation cascade, F9 activation
Disease
H00219  Hemophilia
H00223  Inherited thrombophilia
Drug target
Emicizumab: D10821<JP/US>
Pegnivacogin (DG01399): D10150 D10484
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2158 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2158 (F9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     2158 (F9)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2158 (F9)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition EGF Trypsin_2 DUF1986 cEGF hEGF EGF_3
Other DBs
NCBI-GeneID: 2158
NCBI-ProteinID: NP_000124
OMIM: 300746
HGNC: 3551
Ensembl: ENSG00000101981
Pharos: P00740(Tchem)
CPD: C03259
UniProt: P00740
Structure
Position
X:139530739..139563459
AA seq 461 aa
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
HKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgcagcgcgtgaacatgatcatggcagaatcaccaggcctcatcaccatctgcctttta
ggatatctactcagtgctgaatgtacagtttttcttgatcatgaaaacgccaacaaaatt
ctgaatcggccaaagaggtataattcaggtaaattggaagagtttgttcaagggaacctt
gagagagaatgtatggaagaaaagtgtagttttgaagaagcacgagaagtttttgaaaac
actgaaagaacaactgaattttggaagcagtatgttgatggagatcagtgtgagtccaat
ccatgtttaaatggcggcagttgcaaggatgacattaattcctatgaatgttggtgtccc
tttggatttgaaggaaagaactgtgaattagatgtaacatgtaacattaagaatggcaga
tgcgagcagttttgtaaaaatagtgctgataacaaggtggtttgctcctgtactgaggga
tatcgacttgcagaaaaccagaagtcctgtgaaccagcagtgccatttccatgtggaaga
gtttctgtttcacaaacttctaagctcacccgtgctgagactgtttttcctgatgtggac
tatgtaaattctactgaagctgaaaccattttggataacatcactcaaagcacccaatca
tttaatgacttcactcgggttgttggtggagaagatgccaaaccaggtcaattcccttgg
caggttgttttgaatggtaaagttgatgcattctgtggaggctctatcgttaatgaaaaa
tggattgtaactgctgcccactgtgttgaaactggtgttaaaattacagttgtcgcaggt
gaacataatattgaggagacagaacatacagagcaaaagcgaaatgtgattcgaattatt
cctcaccacaactacaatgcagctattaataagtacaaccatgacattgcccttctggaa
ctggacgaacccttagtgctaaacagctacgttacacctatttgcattgctgacaaggaa
tacacgaacatcttcctcaaatttggatctggctatgtaagtggctggggaagagtcttc
cacaaagggagatcagctttagttcttcagtaccttagagttccacttgttgaccgagcc
acatgtcttcgatctacaaagttcaccatctataacaacatgttctgtgctggcttccat
gaaggaggtagagattcatgtcaaggagatagtgggggaccccatgttactgaagtggaa
gggaccagtttcttaactggaattattagctggggtgaagagtgtgcaatgaaaggcaaa
tatggaatatataccaaggtatcccggtatgtcaactggattaaggaaaaaacaaagctc
acttaa

DBGET integrated database retrieval system