KEGG   Homo sapiens (human): 2165Help
Entry
2165              CDS       T01001                                 

Gene name
F13B, FXIIIB
Definition
(RefSeq) coagulation factor XIII B chain
  KO
K03906  coagulation factor XIII B polypeptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00945  Factor XIII deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2165 (F13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Sushi_2
Motif
Other DBs
NCBI-GeneID: 2165
NCBI-ProteinID: NP_001985
OMIM: 134580
HGNC: 3534
Ensembl: ENSG00000143278
Vega: OTTHUMG00000036519
Pharos: P05160(Tbio)
UniProt: P05160
Position
1q31.3
AA seq 661 aa AA seqDB search
MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMSIDKKLSFFCL
AGYTTESGRQEEQTTCTTEGWSPEPRCFKKCTKPDLSNGYISDVKLLYKIQENMRYGCAS
GYKTTGGKDEEVVQCLSDGWSSQPTCRKEHETCLAPELYNGNYSTTQKTFKVKDKVQYEC
ATGYYTAGGKKTEEVECLTYGWSLTPKCTKLKCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYYLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPINSKIQTHSTTYRHGEIVHI
ECELNFEIHGSAEIRCEDGKWTEPPKCIEGQEKVACEEPPFIENGAANLHSKIYYNGDKV
TYACKSGYLLHGSNEITCNRGKWTLPPECVENNENCKHPPVVMNGAVADGILASYATGSS
VEYRCNEYYLLRGSKISRCEQGKWSSPPVCLEPCTVNVDYMNRNNIEMKWKYEGKVLHGD
LIDFVCKQGYDLSPLTPLSELSVQCNRGEVKYPLCTRKESKGMCTSPPLIKHGVIISSTV
DTYENGSSVEYRCFDHHFLEGSREAYCLDGMWTTPPLCLEPCTLSFTEMEKNNLLLKWDF
DNRPHILHGEYIEFICRGDTYPAELYITGSILRMQCDRGQLKYPRCIPRQSTLSYQEPLR
T
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgaaaaacctgacttttatcatcatattgataatctcaggagaactctatgca
gaagagaaaccctgtggttttcctcatgtggaaaatggaagaattgcccaatattactat
acttttaaaagcttttactttccaatgagcatagacaaaaaattgtcatttttctgcttg
gctggttataccactgaaagtggaagacaagaagagcaaaccacgtgtacaacagaaggc
tggtctccagagccaaggtgcttcaaaaaatgcactaagcctgacctgagtaatggttac
atctctgatgtaaagttattgtataaaattcaagagaacatgcgttatggttgcgcttca
gggtacaaaaccactggagggaaggatgaagaagtggttcaatgtctctctgatggatgg
tcttctcaaccaacctgtaggaaagaacatgaaacatgtttggctcctgaattatataat
ggaaattattccacaacacagaaaacattcaaagtgaaggacaaagtacaatacgaatgt
gctactggctactacacagctggaggaaagaagacagaggaggtagaatgtctcacatac
ggatggtctctcacaccaaaatgtaccaaattaaagtgctcttctttaagattaattgaa
aatggttattttcatcctgtaaagcaaacctatgaagaaggagatgtcgttcagtttttc
tgtcatgaaaattattatctaagtggatctgatttaattcaatgctataactttggttgg
tacccagaatctcctgtatgcgaaggaagaagaaacagatgtcctcctccacctctgccc
ataaactccaaaattcaaacacattcaacaacttatcgtcatggagaaatagttcatata
gaatgtgaacttaattttgagatccatgggtcagcagaaatacgttgtgaagatggaaaa
tggacagaacctccaaaatgcattgaaggacaggagaaggtagcctgtgaggaaccaccc
ttcattgaaaatggtgcagcaaatttacactctaagatttattacaatggggataaagtg
acatatgcatgtaaaagcggctaccttctccatggatcgaatgagataacttgtaatcgt
ggaaaatggacacttcctcctgagtgtgttgaaaataatgagaattgtaagcatcctcct
gttgtaatgaatggggctgttgcagacgggatattggcaagctatgcaacaggatcctca
gtggaatatagatgcaatgaatattacttactgaggggatcaaaaatatctcgttgcgaa
caaggaaaatggtcatccccacctgtttgcttggaaccatgtactgttaatgtggattac
atgaacagaaataacatagaaatgaagtggaaatatgaagggaaagtcttacatggagat
ttaatagattttgtatgtaaacagggatatgacttatctccattaaccccattgtctgaa
ttatctgtgcagtgcaacagaggagaagtgaaatatcctttatgtactagaaaagaatct
aaaggaatgtgcacatctcctcctcttattaaacatggagtcattattagttcaacagta
gacacctatgaaaatggctcttcagtagaatacagatgttttgatcaccatttcctagaa
ggatctagggaggcctattgtttagatggaatgtggactacaccaccattgtgtttagag
ccatgcacattatcttttactgaaatggaaaagaataatttacttctgaaatgggatttt
gacaatagaccacacattttgcatggtgaatatattgagtttatttgtagaggagatact
tatccagctgaattatatattactggatctatacttagaatgcaatgtgacagagggcag
ttaaaatatccaagatgtattccaagacaaagcactctgtcttatcaagaacccttaaga
acatag

DBGET integrated database retrieval system