KEGG   Homo sapiens (human): 2166Help
Entry
2166              CDS       T01001                                 

Gene name
FAAH, FAAH-1, PSAB
Definition
(RefSeq) fatty acid amide hydrolase
  KO
K15528  fatty acid amide hydrolase [EC:3.5.1.99]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    2166 (FAAH)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     2166 (FAAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 2166
NCBI-ProteinID: NP_001432
OMIM: 602935
HGNC: 3553
Ensembl: ENSG00000117480
Vega: OTTHUMG00000007811
Pharos: O00519(Tchem)
UniProt: O00519 Q9UG55
Position
1p33
AA seq 579 aa AA seqDB search
MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQ
RFRLQNPDLDSEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLAD
CETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAV
PFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCE
DMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETKQSLEAAGHTL
VPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALD
LNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMK
KSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtacgagctgtgggccgcgctgcctggcgcctccggggtcgccctggcctgc
tgcttcgtggcggcggccgtggccctgcgctggtccgggcgccggacggcgcggggcgcg
gtggtccgggcgcgacagaggcagcgagcgggcctggagaacatggacagggcggcgcag
cgcttccggctccagaacccagacctggactcagaggcgctgctagccctgcccctgcct
cagctggtgcagaagttacacagtagagagctggcccctgaggccgtgctcttcacctat
gtgggaaaggcctgggaagtgaacaaagggaccaactgtgtgacctcctatctggctgac
tgtgagactcagctgtctcaggccccaaggcagggcctgctctatggcgtccctgtgagc
ctcaaggagtgcttcacctacaagggccaggactccacgctgggcttgagcctgaatgaa
ggggtgccggcggagtgcgacagcgtagtggtgcatgtgctgaagctgcagggtgccgtg
cccttcgtgcacaccaatgttccacagtccatgttcagctatgactgcagtaaccccctc
tttggccagaccgtgaacccatggaagtcctccaaaagcccagggggctcctcagggggt
gaaggggccctcatcgggtctggaggctcccccctgggcttaggcactgatatcggaggc
agcatccgcttcccctcctccttctgcggcatctgcggcctcaagcccacagggaaccgc
ctcagcaagagtggcctgaagggctgtgtctatggacaggaggcagtgcgtctctccgtg
ggccccatggcccgggacgtggagagcctggcactgtgcctgcgagccctgctgtgcgag
gacatgttccgcttggaccccactgtgcctcccttgcccttcagagaagaggtctacacc
agctctcagcccctgcgtgtggggtactatgagactgacaactataccatgccctccccg
gccatgaggcgggccgtgctggagaccaaacagagccttgaggctgcggggcacacgctg
gttcccttcttgccaagcaacataccccatgctctggagaccctgtcaacaggtgggctc
ttcagtgatggtggccacaccttcctacagaacttcaaaggtgatttcgtggacccctgc
ctgggggacctggtctcaattctgaagcttccccaatggcttaaaggactgctggccttc
ctggtgaagcctctgctgccaaggctgtcagctttcctcagcaacatgaagtctcgttcg
gctggaaaactctgggaactgcagcacgagatcgaggtgtaccgcaaaaccgtgattgcc
cagtggagggcgctggacctggatgtggtgctgacccccatgctggcccctgctctggac
ttgaatgccccaggcagggccacaggggccgtcagctacactatgctgtacaactgcctg
gacttccctgcaggggtggtgcctgtcaccacggtgactgctgaggacgaggcccagatg
gaacattacaggggctactttggggatatctgggacaagatgctgcagaagggcatgaag
aagagtgtggggctgccggtggccgtgcagtgtgtggctctgccctggcaagaagagttg
tgtctgcggttcatgcgggaggtggagcgactgatgacccctgaaaagcagtcatcctga

DBGET integrated database retrieval system