KEGG   Homo sapiens (human): 2167Help
Entry
2167              CDS       T01001                                 

Gene name
FABP4, A-FABP, AFABP, ALBP, HEL-S-104, aP2
Definition
(RefSeq) fatty acid binding protein 4
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2167 (FABP4)
   03320 PPAR signaling pathway
    2167 (FABP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 HSP20
Motif
Other DBs
NCBI-GeneID: 2167
NCBI-ProteinID: NP_001433
OMIM: 600434
HGNC: 3559
Ensembl: ENSG00000170323
Vega: OTTHUMG00000164602
Pharos: P15090(Tchem)
UniProt: P15090 E7DVW4
Structure
PDB: 

Position
8q21.13
AA seq 132 aa AA seqDB search
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgcttttgtaggtacctggaaacttgtctccagtgaaaactttgatgattat
atgaaagaagtaggagtgggctttgccaccaggaaagtggctggcatggccaaacctaac
atgatcatcagtgtgaatggggatgtgatcaccattaaatctgaaagtacctttaaaaat
actgagatttccttcatactgggccaggaatttgacgaagtcactgcagatgacaggaaa
gtcaagagcaccataaccttagatgggggtgtcctggtacatgtgcagaaatgggatgga
aaatcaaccaccataaagagaaaacgagaggatgataaactggtggtggaatgcgtcatg
aaaggcgtcacttccacgagagtttatgagagagcataa

DBGET integrated database retrieval system