KEGG   Homo sapiens (human): 2167Help
Entry
2167              CDS       T01001                                 

Gene name
FABP4, A-FABP, AFABP, ALBP, HEL-S-104, aP2
Definition
(RefSeq) fatty acid binding protein 4
  KO
K08753  fatty acid-binding protein 4, adipocyte
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2167 (FABP4)
   03320 PPAR signaling pathway
    2167 (FABP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 HSP20
Motif
Other DBs
NCBI-GeneID: 2167
NCBI-ProteinID: NP_001433
OMIM: 600434
HGNC: 3559
Ensembl: ENSG00000170323
Vega: OTTHUMG00000164602
Pharos: P15090(Tchem)
UniProt: P15090 E7DVW4
Structure
PDB: 

Position
8q21.13
AA seq 132 aa AA seqDB search
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgcttttgtaggtacctggaaacttgtctccagtgaaaactttgatgattat
atgaaagaagtaggagtgggctttgccaccaggaaagtggctggcatggccaaacctaac
atgatcatcagtgtgaatggggatgtgatcaccattaaatctgaaagtacctttaaaaat
actgagatttccttcatactgggccaggaatttgacgaagtcactgcagatgacaggaaa
gtcaagagcaccataaccttagatgggggtgtcctggtacatgtgcagaaatgggatgga
aaatcaaccaccataaagagaaaacgagaggatgataaactggtggtggaatgcgtcatg
aaaggcgtcacttccacgagagtttatgagagagcataa

KEGG   Homo sapiens (human): 2168Help
Entry
2168              CDS       T01001                                 

Gene name
FABP1, FABPL, L-FABP
Definition
(RefSeq) fatty acid binding protein 1
  KO
K08750  fatty acid-binding protein 1, liver
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2168 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    2168 (FABP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin_7 Lipocalin
Motif
Other DBs
NCBI-GeneID: 2168
NCBI-ProteinID: NP_001434
OMIM: 134650
HGNC: 3555
Ensembl: ENSG00000163586
Vega: OTTHUMG00000130312
Pharos: P07148(Tchem)
UniProt: P07148 Q6FGL7 Q05CP7
Structure
PDB: 

Position
2p11.2
AA seq 127 aa AA seqDB search
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctccggcaagtaccaactgcagagccaggaaaactttgaagccttcatgaag
gcaatcggtctgccggaagagctcatccagaaggggaaggatatcaagggggtgtcggaa
atcgtgcagaatgggaagcacttcaagttcaccatcaccgctgggtccaaagtgatccaa
aacgaattcacggtgggggaggaatgtgagctggagacaatgacaggggagaaagtcaag
acagtggttcagttggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaacggcgacataatcaccaataccatgacattgggtgacattgtcttc
aagagaatcagcaagagaatttaa

KEGG   Homo sapiens (human): 2169Help
Entry
2169              CDS       T01001                                 

Gene name
FABP2, FABPI, I-FABP
Definition
(RefSeq) fatty acid binding protein 2
  KO
K08751  fatty acid-binding protein 2, intestinal
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2169 (FABP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    2169 (FABP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 Lipocalin_4
Motif
Other DBs
NCBI-GeneID: 2169
NCBI-ProteinID: NP_000125
OMIM: 134640
HGNC: 3556
Ensembl: ENSG00000145384
Vega: OTTHUMG00000132972
Pharos: P12104(Tchem)
UniProt: P12104
Structure
PDB: 

Position
4q26
AA seq 132 aa AA seqDB search
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgacagcacttggaaggtagaccggagtgaaaactatgacaagttcatggaa
aaaatgggtgttaatatagtgaaaaggaagcttgcagctcatgacaatttgaagctgaca
attacacaagaaggaaataaattcacagtcaaagaatcaagcacttttcgaaacattgaa
gttgtttttgaacttggtgtcacctttaattacaatctagcagacggaactgaactcagg
gggacctggagccttgagggaaataaacttattggaaaattcaaacggacagacaatgga
aacgaactgaatactgtccgagaaattataggtgatgaactagtccagacttatgtatat
gaaggagtagaagccaaaaggatctttaaaaaggattga

KEGG   Homo sapiens (human): 2170Help
Entry
2170              CDS       T01001                                 

Gene name
FABP3, FABP11, H-FABP, M-FABP, MDGI, O-FABP
Definition
(RefSeq) fatty acid binding protein 3
  KO
K08752  fatty acid-binding protein 3, muscle and heart
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2170 (FABP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2170 (FABP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2170 (FABP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 2170
NCBI-ProteinID: NP_004093
OMIM: 134651
HGNC: 3557
Ensembl: ENSG00000121769
Vega: OTTHUMG00000003797
Pharos: P05413(Tchem)
UniProt: P05413 A0A384MDY5
Structure
PDB: 

Position
1p35.2
AA seq 133 aa AA seqDB search
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH
GTAVCTRTYEKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtggacgctttcctgggcacctggaagctagtggacagcaagaatttcgatgactac
atgaagtcactcggtgtgggttttgctaccaggcaggtggccagcatgaccaagcctacc
acaatcatcgaaaagaatggggacattctcaccctaaaaacacacagcaccttcaagaac
acagagatcagctttaagttgggggtggagttcgatgagacaacagcagatgacaggaag
gtcaagtccattgtgacactggatggagggaaacttgttcacctgcagaaatgggacggg
caagagaccacacttgtgcgggagctaattgatggaaaactcatcctgacactcacccac
ggcactgcagtttgcactcgcacttatgagaaagaggcatga

KEGG   Homo sapiens (human): 2171Help
Entry
2171              CDS       T01001                                 

Gene name
FABP5, E-FABP, EFABP, KFABP, PA-FABP, PAFABP
Definition
(RefSeq) fatty acid binding protein 5
  KO
K08754  fatty acid-binding protein 5, epidermal
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2171 (FABP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 DUF1967
Motif
Other DBs
NCBI-GeneID: 2171
NCBI-ProteinID: NP_001435
OMIM: 605168
HGNC: 3560
Ensembl: ENSG00000164687
Vega: OTTHUMG00000134313
Pharos: Q01469(Tchem)
UniProt: Q01469 E7DVW5
Structure
PDB: 

Position
8q21.13
AA seq 135 aa AA seqDB search
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccacagttcagcagctggaaggaagatggcgcctggtggacagcaaaggctttgat
gaatacatgaaggagctaggagtgggaatagctttgcgaaaaatgggcgcaatggccaag
ccagattgtatcatcacttgtgatggtaaaaacctcaccataaaaactgagagcactttg
aaaacaacacagttttcttgtaccctgggagagaagtttgaagaaaccacagctgatggc
agaaaaactcagactgtctgcaactttacagatggtgcattggttcagcatcaggagtgg
gatgggaaggaaagcacaataacaagaaaattgaaagatgggaaattagtggtggagtgt
gtcatgaacaatgtcacctgtactcggatctatgaaaaagtagaataa

KEGG   Homo sapiens (human): 2172Help
Entry
2172              CDS       T01001                                 

Gene name
FABP6, I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
Definition
(RefSeq) fatty acid binding protein 6
  KO
K08755  fatty acid-binding protein 6, ileal (gastrotropin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2172 (FABP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin_7 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 2172
NCBI-ProteinID: NP_001436
OMIM: 600422
HGNC: 3561
Ensembl: ENSG00000170231
Vega: OTTHUMG00000130329
Pharos: P51161(Tbio)
UniProt: P51161
Structure
PDB: 

Position
5q33.3
AA seq 128 aa AA seqDB search
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaccggcaagttcgagatggagagtgagaagaattatgatgagttcatgaag
ctccttgggatctccagcgatgtaatcgaaaaggcccgcaacttcaagatcgtcacggag
gtgcagcaggatgggcaggacttcacttggtcccagcactactccgggggccacaccatg
accaacaagttcactgttggcaaggaaagcaacatacagacaatggggggcaagacgttc
aaggccactgtgcagatggagggcgggaagctggtggtgaatttccccaactatcaccag
acctcagagatcgtgggtgacaagctggtggaggtctccaccatcggaggcgtgacctat
gagcgcgtgagcaagagactggcctaa

KEGG   Homo sapiens (human): 2173Help
Entry
2173              CDS       T01001                                 

Gene name
FABP7, B-FABP, BLBP, FABPB, MRG
Definition
(RefSeq) fatty acid binding protein 7
  KO
K08756  fatty acid-binding protein 7, brain
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2173 (FABP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 2173
NCBI-ProteinID: NP_001437
OMIM: 602965
HGNC: 3562
Ensembl: ENSG00000164434
Vega: OTTHUMG00000015489
Pharos: O15540(Tbio)
UniProt: O15540
Structure
PDB: 

Position
6q22.31
AA seq 132 aa AA seqDB search
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggctttctgtgctacctggaagctgaccaacagtcagaactttgatgagtac
atgaaggctctaggcgtgggctttgccactaggcaggtgggaaatgtgaccaaaccaacg
gtaattatcagtcaagaaggagacaaagtggtcatcaggactctcagcacattcaagaac
acggagattagtttccagctgggagaagagtttgatgaaaccactgcagatgatagaaac
tgtaagtctgttgttagcctggatggagacaaacttgttcacatacagaaatgggatggc
aaagaaacaaattttgtaagagaaattaaggatggcaaaatggttatgacccttactttt
ggtgatgtggttgctgttcgccactatgagaaggcataa

DBGET integrated database retrieval system