KEGG   Homo sapiens (human): 2168Help
Entry
2168              CDS       T01001                                 

Gene name
FABP1, FABPL, L-FABP
Definition
(RefSeq) fatty acid binding protein 1
  KO
K08750  fatty acid-binding protein 1, liver
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2168 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    2168 (FABP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin_7 Lipocalin
Motif
Other DBs
NCBI-GeneID: 2168
NCBI-ProteinID: NP_001434
OMIM: 134650
HGNC: 3555
Ensembl: ENSG00000163586
Vega: OTTHUMG00000130312
Pharos: P07148(Tchem)
UniProt: P07148 Q6FGL7 Q05CP7
Structure
PDB: 

Position
2p11.2
AA seq 127 aa AA seqDB search
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctccggcaagtaccaactgcagagccaggaaaactttgaagccttcatgaag
gcaatcggtctgccggaagagctcatccagaaggggaaggatatcaagggggtgtcggaa
atcgtgcagaatgggaagcacttcaagttcaccatcaccgctgggtccaaagtgatccaa
aacgaattcacggtgggggaggaatgtgagctggagacaatgacaggggagaaagtcaag
acagtggttcagttggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaacggcgacataatcaccaataccatgacattgggtgacattgtcttc
aagagaatcagcaagagaatttaa

DBGET integrated database retrieval system