KEGG   Homo sapiens (human): 2168
Entry
2168              CDS       T01001                                 

Symbol
FABP1, FABPL, L-FABP
Name
(RefSeq) fatty acid binding protein 1
  KO
K08750  fatty acid-binding protein 1, liver
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04936  Alcoholic liver disease
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2168 (FABP1)
  09154 Digestive system
   04975 Fat digestion and absorption
    2168 (FABP1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    2168 (FABP1)
SSDB
Motif
Pfam: Lipocalin_7 Lipocalin
Other DBs
NCBI-GeneID: 2168
NCBI-ProteinID: NP_001434
OMIM: 134650
HGNC: 3555
Ensembl: ENSG00000163586
Vega: OTTHUMG00000130312
Pharos: P07148(Tchem)
UniProt: P07148 Q6FGL7 Q05CP7
Structure
PDB: 

Position
2p11.2
AA seq 127 aa
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQ
NEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVF
KRISKRI
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagtttctccggcaagtaccaactgcagagccaggaaaactttgaagccttcatgaag
gcaatcggtctgccggaagagctcatccagaaggggaaggatatcaagggggtgtcggaa
atcgtgcagaatgggaagcacttcaagttcaccatcaccgctgggtccaaagtgatccaa
aacgaattcacggtgggggaggaatgtgagctggagacaatgacaggggagaaagtcaag
acagtggttcagttggaaggtgacaataaactggtgacaactttcaaaaacatcaagtct
gtgaccgaactcaacggcgacataatcaccaataccatgacattgggtgacattgtcttc
aagagaatcagcaagagaatttaa

DBGET integrated database retrieval system