KEGG   Homo sapiens (human): 2169
Entry
2169              CDS       T01001                                 

Gene name
FABP2, FABPI, I-FABP
Definition
(RefSeq) fatty acid binding protein 2
  KO
K08751  fatty acid-binding protein 2, intestinal
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2169 (FABP2)
  09154 Digestive system
   04975 Fat digestion and absorption
    2169 (FABP2)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 Lipocalin_4
Other DBs
NCBI-GeneID: 2169
NCBI-ProteinID: NP_000125
OMIM: 134640
HGNC: 3556
Ensembl: ENSG00000145384
Vega: OTTHUMG00000132972
Pharos: P12104(Tchem)
UniProt: P12104
Structure
PDB: 

Position
4q26
AA seq 132 aa
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIE
VVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVY
EGVEAKRIFKKD
NT seq 399 nt   +upstreamnt  +downstreamnt
atggcgtttgacagcacttggaaggtagaccggagtgaaaactatgacaagttcatggaa
aaaatgggtgttaatatagtgaaaaggaagcttgcagctcatgacaatttgaagctgaca
attacacaagaaggaaataaattcacagtcaaagaatcaagcacttttcgaaacattgaa
gttgtttttgaacttggtgtcacctttaattacaatctagcagacggaactgaactcagg
gggacctggagccttgagggaaataaacttattggaaaattcaaacggacagacaatgga
aacgaactgaatactgtccgagaaattataggtgatgaactagtccagacttatgtatat
gaaggagtagaagccaaaaggatctttaaaaaggattga

DBGET integrated database retrieval system