KEGG   Homo sapiens (human): 217Help
Entry
217               CDS       T01001                                 

Gene name
ALDH2, ALDH-E2, ALDHI, ALDM
Definition
(RefSeq) aldehyde dehydrogenase 2 family member
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01071  Acute alcohol sensitivity
H01611  Alcohol dependence
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    217 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    217 (ALDH2)
   00620 Pyruvate metabolism
    217 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    217 (ALDH2)
   00561 Glycerolipid metabolism
    217 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    217 (ALDH2)
   00310 Lysine degradation
    217 (ALDH2)
   00330 Arginine and proline metabolism
    217 (ALDH2)
   00340 Histidine metabolism
    217 (ALDH2)
   00380 Tryptophan metabolism
    217 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    217 (ALDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     217 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1235
Motif
Other DBs
NCBI-GeneID: 217
NCBI-ProteinID: NP_000681
OMIM: 100650
HGNC: 404
Ensembl: ENSG00000111275
Vega: OTTHUMG00000169603
Pharos: P05091(Tclin)
UniProt: P05091 A0A384NPN7
Structure
PDB: 

Position
12q24.12
AA seq 517 aa AA seqDB search
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgctgccgcccgcttcgggccccgcctgggccgccgcctcttgtcagccgcc
gccacccaggccgtgcctgcccccaaccagcagcccgaggtcttctgcaaccagattttc
ataaacaatgaatggcacgatgccgtcagcaggaaaacattccccaccgtcaatccgtcc
actggagaggtcatctgtcaggtagctgaaggggacaaggaagatgtggacaaggcagtg
aaggccgcccgggccgccttccagctgggctcaccttggcgccgcatggacgcatcacac
aggggccggctgctgaaccgcctggccgatctgatcgagcgggaccggacctacctggcg
gccttggagaccctggacaatggcaagccctatgtcatctcctacctggtggatttggac
atggtcctcaaatgtctccggtattatgccggctgggctgataagtaccacgggaaaacc
atccccattgacggagacttcttcagctacacacgccatgaacctgtgggggtgtgcggg
cagatcattccgtggaatttcccgctcctgatgcaagcatggaagctgggcccagccttg
gcaactggaaacgtggttgtgatgaaggtagctgagcagacacccctcaccgccctctat
gtggccaacctgatcaaggaggctggctttccccctggtgtggtcaacattgtgcctgga
tttggccccacggctggggccgccattgcctcccatgaggatgtggacaaagtggcattc
acaggctccactgagattggccgcgtaatccaggttgctgctgggagcagcaacctcaag
agagtgaccttggagctgggggggaagagccccaacatcatcatgtcagatgccgatatg
gattgggccgtggaacaggcccacttcgccctgttcttcaaccagggccagtgctgctgt
gccggctcccggaccttcgtgcaggaggacatctatgatgagtttgtggagcggagcgtt
gcccgggccaagtctcgggtggtcgggaacccctttgatagcaagaccgagcaggggccg
caggtggatgaaactcagtttaagaagatcctcggctacatcaacacggggaagcaagag
ggggcgaagctgctgtgtggtgggggcattgctgctgaccgtggttacttcatccagccc
actgtgtttggagatgtgcaggatggcatgaccatcgccaaggaggagatcttcgggcca
gtgatgcagatcctgaagttcaagaccatagaggaggttgttgggagagccaacaattcc
acgtacgggctggccgcagctgtcttcacaaaggatttggacaaggccaattacctgtcc
caggccctccaggcgggcactgtgtgggtcaactgctatgatgtgtttggagcccagtca
ccctttggtggctacaagatgtcggggagtggccgggagttgggcgagtacgggctgcag
gcatacactgaagtgaaaactgtcacagtcaaagtgcctcagaagaactcataa

KEGG   Homo sapiens (human): 219Help
Entry
219               CDS       T01001                                 

Gene name
ALDH1B1, ALDH5, ALDHX
Definition
(RefSeq) aldehyde dehydrogenase 1 family member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    219 (ALDH1B1)
   00053 Ascorbate and aldarate metabolism
    219 (ALDH1B1)
   00620 Pyruvate metabolism
    219 (ALDH1B1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    219 (ALDH1B1)
   00561 Glycerolipid metabolism
    219 (ALDH1B1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    219 (ALDH1B1)
   00310 Lysine degradation
    219 (ALDH1B1)
   00330 Arginine and proline metabolism
    219 (ALDH1B1)
   00340 Histidine metabolism
    219 (ALDH1B1)
   00380 Tryptophan metabolism
    219 (ALDH1B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    219 (ALDH1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     219 (ALDH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 219
NCBI-ProteinID: NP_000683
OMIM: 100670
HGNC: 407
Ensembl: ENSG00000137124
Vega: OTTHUMG00000019938
Pharos: P30837(Tbio)
UniProt: P30837 A0A384MTJ7
Position
9p13.1
AA seq 517 aa AA seqDB search
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctggcaccccggctgcttagcctccagggcaggaccgcccgctactcc
tcggcagcagccctcccaagccccattctgaacccagacatcccctacaaccagctgttc
atcaacaatgaatggcaagatgcagtcagcaagaagaccttcccgacggtcaaccctacc
accggggaggtcattgggcacgtggctgaaggtgaccgggctgatgtggatcgggccgtg
aaagcagcccgggaagccttccgcctggggtccccatggcgccggatggatgcctctgag
cggggccggctgctgaaccgcctggcagacctagtggagcgggatcgagtctacttggcc
tcactcgagaccttggacaatgggaagcctttccaagagtcttacgccttggacttggat
gaggtcatcaaggtgtatcggtactttgctggctgggctgacaagtggcatggcaagacc
atccccatggatggccagcatttctgcttcacccggcatgagcccgttggtgtctgtggc
cagatcatcccgtggaacttccccttggtcatgcagggttggaaacttgccccggcactc
gccacaggcaacactgtggttatgaaggtggcagagcagacccccctctctgccctgtat
ttggcctccctcatcaaggaggcaggctttccccctggggtggtgaacatcatcacgggg
tatggcccaacagcaggtgcggccatcgcccagcacgtggatgttgacaaagttgccttc
accggttccaccgaggtgggccacctgatccagaaagcagctggcgattccaacctcaag
agagtcaccctggagctgggtggtaagagccccagcatcgtgctggccgatgctgacatg
gagcatgccgtggagcagtgccacgaagccctgttcttcaacatgggccagtgctgctgt
gctggctcccggaccttcgtggaagaatccatctacaatgagtttctcgagagaaccgtg
gagaaagcaaagcagaggaaagtggggaacccctttgagctggacacccagcaggggcct
caggtggacaaggagcagtttgaacgagtcctaggctacatccagcttggccagaaggag
ggcgcaaaactcctctgtggcggagagcgtttcggggagcgtggtttcttcatcaagcct
actgtctttggtggcgtgcaggatgacatgagaattgccaaagaggagatctttgggcct
gtgcagcccctgttcaagttcaagaagattgaggaggtggttgagagggccaacaacacc
aggtatggcctggctgcggctgtgttcacccgggatctggacaaggccatgtacttcacc
caggcactccaggccgggaccgtgtgggtaaacacctacaacatcgtcacctgccacacg
ccatttggagggtttaaggaatctggaaacgggagggagctgggtgaggatgggcttaag
gcctacacagaggtaaagacggtcaccatcaaggttcctcagaagaactcgtaa

KEGG   Homo sapiens (human): 223Help
Entry
223               CDS       T01001                                 

Gene name
ALDH9A1, ALDH4, ALDH7, ALDH9, E3, TMABA-DH, TMABADH, TMABALDH
Definition
(RefSeq) aldehyde dehydrogenase 9 family member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    223 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    223 (ALDH9A1)
   00620 Pyruvate metabolism
    223 (ALDH9A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    223 (ALDH9A1)
   00561 Glycerolipid metabolism
    223 (ALDH9A1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    223 (ALDH9A1)
   00310 Lysine degradation
    223 (ALDH9A1)
   00330 Arginine and proline metabolism
    223 (ALDH9A1)
   00340 Histidine metabolism
    223 (ALDH9A1)
   00380 Tryptophan metabolism
    223 (ALDH9A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    223 (ALDH9A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     223 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     223 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-GeneID: 223
NCBI-ProteinID: NP_000687
OMIM: 602733
HGNC: 412
Ensembl: ENSG00000143149
Vega: OTTHUMG00000034677
Pharos: P49189(Tbio)
UniProt: P49189
Structure
PDB: 

Position
1q24.1
AA seq 518 aa AA seqDB search
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccgagcaggcctggccgcgctctccccgcttcttcgcagtcttcggccctct
cctgtcgccgccatgagcactggcaccttcgtcgtgtcgcagccgctcaattaccgcggc
ggggcccgcgtggagccggcggacgcctccggtaccgagaaagctttcgagccagcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcaa
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccaggataataagggaacgggaggatgaaattgctactatggagtgc
atcaacaatggcaagtccatctttgaggcccgcttggacattgacatttcctggcagtgc
ctggagtattatgcgggcttggctgcatccatggctggtgaacacatccagctcccaggt
ggatcgtttggttataccagaagagaaccacttggggtatgtgtgggaataggagcatgg
aactacccctttcagattgcctcttggaagtcggctccagcattagcctgtggtaatgcc
atggtctttaaaccttctccctttacacctgtttctgcattgctactggctgaaatctac
agtgaggctggtgtacctcctgggctcttcaatgtggtgcagggaggggctgccacaggc
cagtttctgtgtcagcatcccgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatgtcagctaaaggaatcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaatgctgtaaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagacccaaaggattaaa
attggagatccccttctggaagatacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgtcaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatatatatgtacctgaagatcccaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagacgacatgacctgtgtgaaggaagagatctttgggcctgtt
atgtccattttatcatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccaacgggctcatagagtggtagct
gagcttcaggctgggacgtgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaatcgaatat
tattcacagctgaagactgtgtgtgtggagatgggtgatgtggaatctgctttttga

KEGG   Homo sapiens (human): 224Help
Entry
224               CDS       T01001                                 

Gene name
ALDH3A2, ALDH10, FALDH, SLS
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00162  Sjogren-Larsson syndrome
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    224 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    224 (ALDH3A2)
   00620 Pyruvate metabolism
    224 (ALDH3A2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    224 (ALDH3A2)
   00561 Glycerolipid metabolism
    224 (ALDH3A2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    224 (ALDH3A2)
   00310 Lysine degradation
    224 (ALDH3A2)
   00330 Arginine and proline metabolism
    224 (ALDH3A2)
   00340 Histidine metabolism
    224 (ALDH3A2)
   00380 Tryptophan metabolism
    224 (ALDH3A2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    224 (ALDH3A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     224 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC PT-HINT
Motif
Other DBs
NCBI-GeneID: 224
NCBI-ProteinID: NP_000373
OMIM: 609523
HGNC: 403
Ensembl: ENSG00000072210
Vega: OTTHUMG00000059471
Pharos: P51648(Tbio)
UniProt: P51648
Structure
PDB: 

Position
17p11.2
AA seq 485 aa AA seqDB search
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgaagtccggcgggtccgacaggcgttcctgtccggccggtcgcgacctctg
cggtttcggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggat
atcctgacggccatcgccgccgacctgtgcaagagtgaattcaatgtgtacagtcaggaa
gtcattactgtccttggggaaattgattttatgcttgagaatcttcctgaatgggttact
gctaaaccagttaagaagaacgtgctcaccatgctggatgaggcctatattcagccacag
cctctgggagtggtgctgataatcggagcttggaattaccccttcgttctcaccattcag
ccactgataggagccatcgctgcaggaaatgctgtgattataaagccttctgaactgagt
gaaaatacagccaagatcttggcaaagcttctccctcagtatttagaccaggatctctat
attgttattaatggtggtgttgaggaaaccacggagctcctgaagcagcgatttgaccac
attttctatacgggaaacactgcggttggcaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgactcttgaactgggagggaaaagtccatgttatattgataaagattgt
gacctggacattgtttgcagacgcataacctggggaaaatacatgaattgtggccaaacc
tgcattgcacccgactatattctctgtgaagcatccctccaaaatcaaattgtatggaag
attaaggaaacagtgaaggaattttatggagaaaatataaaagagtctcctgattatgaa
aggatcatcaatcttcgtcattttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggggagactgatgaggccacacgctacatagccccaacagtacttaccgat
gttgatcctaaaaccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggct
ctttatgtattttcgcataaccataagctcatcaaacggatgattgatgagacatccagt
ggaggtgtcacaggcaatgacgtcattatgcacttcacgctcaactctttcccatttgga
ggagtgggttccagtgggatgggagcttatcacggaaaacatagttttgatactttttct
catcagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatat
cctcccaacagccagtcaaaggtggattggggaaaattttttctcttgaaacggttcaac
aaagaaaaactcggtctcctgttgctcactttcctgggtattgtagccgctgtgcttgtc
aaggcagaatattactga

KEGG   Homo sapiens (human): 501Help
Entry
501               CDS       T01001                                 

Gene name
ALDH7A1, ATQ1, EPD, PDE
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00260  Glycine, serine and threonine metabolism
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H01247  Pyridoxine-dependent epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    501 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    501 (ALDH7A1)
   00620 Pyruvate metabolism
    501 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    501 (ALDH7A1)
   00561 Glycerolipid metabolism
    501 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    501 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    501 (ALDH7A1)
   00310 Lysine degradation
    501 (ALDH7A1)
   00330 Arginine and proline metabolism
    501 (ALDH7A1)
   00340 Histidine metabolism
    501 (ALDH7A1)
   00380 Tryptophan metabolism
    501 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    501 (ALDH7A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     501 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     501 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     501 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 501
NCBI-ProteinID: NP_001173
OMIM: 107323
HGNC: 877
Ensembl: ENSG00000164904
Vega: OTTHUMG00000128942
Pharos: P49419(Tbio)
UniProt: P49419
Structure
PDB: 

Position
5q23.2
AA seq 539 aa AA seqDB search
MWRLPRALCVHAAKTSKLSGPWSRPAAFMSTLLINQPQYAWLKELGLREENEGVYNGSWG
GRGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWKIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERSGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVGLMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFIHESIHDEVVNRLKKAYAQIRVG
NPWDPNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLGHD
ASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgccttcctcgcgcgctgtgtgtgcacgctgcaaagaccagcaagctctctgga
ccttggagcaggcctgccgccttcatgtccactctcctcatcaatcagccccagtatgcg
tggctgaaagagctggggctccgcgaggaaaacgagggcgtgtataatggaagctgggga
ggccggggagaggttattacgacctattgccctgctaacaacgagccaatagcaagagtc
cgacaggccagtgtggcagactatgaagaaactgtaaagaaagcaagagaagcatggaaa
atctgggcagatattcctgctccaaaacgaggagaaatagtaagacagattggcgatgcc
ttgcgggagaagatccaagtactaggaagcttggtgtctttggagatggggaaaatctta
gtggaaggtgtgggtgaagttcaggagtatgtggatatctgtgactatgctgttggttta
tcaaggatgattggaggacctatcttgccttctgaaagatctggccatgcactgattgag
cagtggaatcccgtaggcctggttggaatcatcacggcattcaatttccctgtggcagtg
tatggttggaacaacgccatcgccatgatctgtggaaatgtctgcctctggaaaggagct
ccaaccacttccctcattagtgtggctgtcacaaagataatagccaaggttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagatattggcacagca
atggccaaagatgaacgagtgaacctgctgtccttcactgggagcactcaggtgggaaaa
caggtgggcctgatggtgcaggagaggtttgggagaagtctgttggaacttggaggaaac
aatgccattattgcctttgaagatgcagacctcagcttagttgttccatcagctctcttc
gctgctgtgggaacagctggccagaggtgtaccactgcgaggcgactgtttatacatgaa
agcatccatgatgaggttgtaaacagacttaaaaaggcctatgcacagatccgagttggg
aacccatgggaccctaatgttctctatgggccactccacaccaagcaggcagtgagcatg
tttcttggagcagtggaagaagcaaagaaagaaggtggcacagtggtctatgggggcaag
gttatggatcgccctggaaattatgtagaaccgacaattgtgacaggtcttggccacgat
gcgtccattgcacacacagagacttttgctccgattctctatgtctttaaattcaagaat
gaagaagaggtctttgcatggaataatgaagtaaaacagggactttcaagtagcatcttt
accaaagatctgggcagaatctttcgctggcttggacctaaaggatcagactgtggcatt
gtaaatgtcaacattccaacaagtggggctgagattggaggtgcctttggaggagaaaag
cacactggtggtggcagggagtctggcagtgatgcctggaaacagtacatgagaaggtct
acttgtactatcaactacagtaaagaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system