KEGG   Homo sapiens (human): 2171Help
Entry
2171              CDS       T01001                                 

Gene name
FABP5, E-FABP, EFABP, KFABP, PA-FABP, PAFABP
Definition
(RefSeq) fatty acid binding protein 5
  KO
K08754  fatty acid-binding protein 5, epidermal
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2171 (FABP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7 DUF1967
Motif
Other DBs
NCBI-GeneID: 2171
NCBI-ProteinID: NP_001435
OMIM: 605168
HGNC: 3560
Ensembl: ENSG00000164687
Vega: OTTHUMG00000134313
Pharos: Q01469(Tchem)
UniProt: Q01469 E7DVW5
Structure
PDB: 

Position
8q21.13
AA seq 135 aa AA seqDB search
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggccacagttcagcagctggaaggaagatggcgcctggtggacagcaaaggctttgat
gaatacatgaaggagctaggagtgggaatagctttgcgaaaaatgggcgcaatggccaag
ccagattgtatcatcacttgtgatggtaaaaacctcaccataaaaactgagagcactttg
aaaacaacacagttttcttgtaccctgggagagaagtttgaagaaaccacagctgatggc
agaaaaactcagactgtctgcaactttacagatggtgcattggttcagcatcaggagtgg
gatgggaaggaaagcacaataacaagaaaattgaaagatgggaaattagtggtggagtgt
gtcatgaacaatgtcacctgtactcggatctatgaaaaagtagaataa

DBGET integrated database retrieval system