KEGG   Homo sapiens (human): 2172Help
Entry
2172              CDS       T01001                                 

Gene name
FABP6, I-15P, I-BABP, I-BALB, I-BAP, ILBP, ILBP3, ILLBP
Definition
(RefSeq) fatty acid binding protein 6
  KO
K08755  fatty acid-binding protein 6, ileal (gastrotropin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    2172 (FABP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin_7 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 2172
NCBI-ProteinID: NP_001436
OMIM: 600422
HGNC: 3561
Ensembl: ENSG00000170231
Vega: OTTHUMG00000130329
Pharos: P51161(Tbio)
UniProt: P51161
Structure
PDB: 

Position
5q33.3
AA seq 128 aa AA seqDB search
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaccggcaagttcgagatggagagtgagaagaattatgatgagttcatgaag
ctccttgggatctccagcgatgtaatcgaaaaggcccgcaacttcaagatcgtcacggag
gtgcagcaggatgggcaggacttcacttggtcccagcactactccgggggccacaccatg
accaacaagttcactgttggcaaggaaagcaacatacagacaatggggggcaagacgttc
aaggccactgtgcagatggagggcgggaagctggtggtgaatttccccaactatcaccag
acctcagagatcgtgggtgacaagctggtggaggtctccaccatcggaggcgtgacctat
gagcgcgtgagcaagagactggcctaa

DBGET integrated database retrieval system