KEGG   Homo sapiens (human): 2173Help
Entry
2173              CDS       T01001                                 

Gene name
FABP7, B-FABP, BLBP, FABPB, MRG
Definition
(RefSeq) fatty acid binding protein 7
  KO
K08756  fatty acid-binding protein 7, brain
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    2173 (FABP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin Lipocalin_7
Motif
Other DBs
NCBI-GeneID: 2173
NCBI-ProteinID: NP_001437
OMIM: 602965
HGNC: 3562
Ensembl: ENSG00000164434
Vega: OTTHUMG00000015489
Pharos: O15540(Tbio)
UniProt: O15540
Structure
PDB: 

Position
6q22.31
AA seq 132 aa AA seqDB search
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKN
TEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTF
GDVVAVRHYEKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggctttctgtgctacctggaagctgaccaacagtcagaactttgatgagtac
atgaaggctctaggcgtgggctttgccactaggcaggtgggaaatgtgaccaaaccaacg
gtaattatcagtcaagaaggagacaaagtggtcatcaggactctcagcacattcaagaac
acggagattagtttccagctgggagaagagtttgatgaaaccactgcagatgatagaaac
tgtaagtctgttgttagcctggatggagacaaacttgttcacatacagaaatgggatggc
aaagaaacaaattttgtaagagaaattaaggatggcaaaatggttatgacccttactttt
ggtgatgtggttgctgttcgccactatgagaaggcataa

DBGET integrated database retrieval system