KEGG   Homo sapiens (human): 2177Help
Entry
2177              CDS       T01001                                 

Gene name
FANCD2, FA-D2, FA4, FACD, FAD, FAD2, FANCD
Definition
(RefSeq) FA complementation group D2
  KO
K10891  fanconi anemia group D2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    2177 (FANCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2177 (FANCD2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     2177 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 Trans_coact MKT1_N
Motif
Other DBs
NCBI-GeneID: 2177
NCBI-ProteinID: NP_001018125
OMIM: 613984
HGNC: 3585
Ensembl: ENSG00000144554
Vega: OTTHUMG00000128670
Pharos: Q9BXW9(Tbio)
UniProt: Q9BXW9 A0A024R2G2
Position
3p25.3
AA seq 1451 aa AA seqDB search
MVSKRRLSKSEDKESLTEDASKTRKQPLSKKTKKSHIANEVEENDSIFVKLLKISGIILK
TGESQNQLAVDQIAFQKKLFQTLRRHPSYPKIIEEFVSGLESYIEDEDSFRNCLLSCERL
QDEEASMGASYSKSLIKLLLGIDILQPAIIKTLFEKLPEYFFENKNSDEINIPRLIVSQL
KWLDRVVDGKDLTTKIMQLISIAPENLQHDIITSLPEILGDSQHADVGKELSDLLIENTS
LTVPILDVLSSLRLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISE
LREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFDVIKSAIRYEKTI
SEAWIKAIENTASVSEHKVFDLVMLFIIYSTNTQTKKYIDRVLRNKIRSGCIQEQLLQST
FSVHYLVLKDMCSSILSLAQSLLHSLDQSIISFGSLLYKYAFKFFDTYCQQEVVGALVTH
ICSGNEAEVDTALDVLLELVVLNPSAMMMNAVFVKGILDYLDNISPQQIRKLFYVLSTLA
FSKQNEASSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGIMAADRSESPSLTQERA
NLSDEQCTQVTSLLQLVHSCSEQSPQASALYYDEFANLIQHEKLDPKALEWVGHTICNDF
QDAFVVDSCVVPEGDFPFPVKALYGLEEYDTQDGIAINLLPLLFSQDFAKDGGPVTSQES
GQKLVSPLCLAPYFRLLRLCVERQHNGNLEEIDGLLDCPIFLTDLEPGEKLESMSAKERS
FMCSLIFLTLNWFREIVNAFCQETSPEMKGKVLTRLKHIVELQIILEKYLAVTPDYVPPL
GNFDVETLDITPHTVTAISAKIRKKGKIERKQKTDGSKTSSSDTLSEEKNSECDPTPSHR
GQLNKEFTGKEEKTSLLLHNSHAFFRELDIEVFSILHCGLVTKFILDTEMHTEATEVVQL
GPPELLFLLEDLSQKLESMLTPPIARRVPFLKNKGSRNIGFSHLQQRSAQEIVHCVFQLL
TPMCNHLENIHNYFQCLAAENHGVVDGPGVKVQEYHIMSSCYQRLLQIFHGLFAWSGFSQ
PENQNLLYSALHVLSSRLKQGEHSQPLEELLSQSVHYLQNFHQSIPSFQCALYLIRLLMV
ILEKSTASAQNKEKIASLARQFLCRVWPSGDKEKSNISNDQLHALLCIYLEHTESILKAI
EEIAGVGVPELINSPKDASSSTFPTLTRHTFVVFFRVMMAELEKTVKKIEPGTAADSQQI
HEEKLLYWNMAVRDFSILINLIKVFDSHPVLHVCLKYGRLFVEAFLKQCMPLLDFSFRKH
REDVLSLLETFQLDTRLLHHLCGHSKIHQDTRLTQHVPLLKKTLELLVCRVKAMLTLNNC
REAFWLGNLKNRDLQGEEIKSQNSQESTADESEDDMSSQASKSKATEDGEEDEVSAGEKE
QDSDESYDDSD
NT seq 4356 nt NT seq  +upstreamnt  +downstreamnt
atggtttccaaaagaagactgtcaaaatctgaggataaagagagcctgacagaagatgcc
tccaaaaccaggaagcaaccactttccaaaaagacaaagaaatctcatattgctaatgaa
gttgaagaaaatgacagcatctttgtaaagcttcttaagatatcaggaattattcttaaa
acgggagagagtcagaatcaactagctgtggatcaaatagctttccaaaagaagctcttt
cagaccctgaggagacacccttcctatcccaaaataatagaagaatttgttagtggcctg
gagtcttacattgaggatgaagacagtttcaggaactgccttttgtcttgtgagcgtctg
caggatgaggaagccagtatgggtgcatcttattctaagagtctcatcaaactgcttctg
gggattgacatactgcagcctgccattatcaaaaccttatttgagaagttgccagaatat
ttttttgaaaacaagaacagtgatgaaatcaacatacctcgactcattgtcagtcaacta
aaatggcttgacagagttgtggatggcaaggacctcaccaccaagatcatgcagctgatc
agtattgctccagagaacctgcagcatgacatcatcaccagcctacctgagatcctaggg
gattcccagcacgctgatgtggggaaagaactcagtgacctactgatagagaatacttca
ctcactgtcccaatcctggatgtcctttcaagcctccgacttgacccaaacttcctattg
aaggttcgccagttggtgatggataagttgtcgtctattagattggaggatttacctgtg
ataataaagttcattcttcattccgtaacagccatggatacacttgaggtaatttctgag
cttcgggagaagttggatctgcagcattgtgttttgccatcacggttacaggcttcccaa
gtaaagttgaaaagtaaaggacgagcaagttcctcaggaaatcaagaaagcagcggtcag
agctgtattattctcctctttgatgtaataaagtcagctattagatatgagaaaaccatt
tcagaagcctggattaaggcaattgaaaacactgcctcagtatctgaacacaaggtgttt
gacctggtgatgcttttcatcatctatagcaccaatactcagacaaagaagtacattgac
agggtgctaagaaataagattcgatcaggctgcattcaagaacagctgctccagagtaca
ttctctgttcattacttagttcttaaggatatgtgttcatccattctgtcgctggctcag
agtttgcttcactctctagaccagagtataatttcatttggcagtctcctatacaaatat
gcatttaagttttttgacacgtactgccagcaggaagtggttggtgccttagtgacccat
atctgcagtgggaatgaagctgaagttgatactgccttagatgtccttctagagttggta
gtgttaaacccatctgctatgatgatgaatgctgtctttgtaaagggcattttagattat
ctggataacatatcccctcagcaaatacgaaaactcttctatgttctcagcacactggca
tttagcaaacagaatgaagccagcagccacatccaggatgacatgcacttggtgataaga
aagcagctctctagcaccgtattcaagtacaagctcattgggattattggtgctgtgacc
atggctggcatcatggcggcagacagaagtgaatcacctagtttgacccaagagagagcc
aacctgagcgatgagcagtgcacacaggtgacctccttgttgcagttggttcattcctgc
agtgagcagtctcctcaggcctctgcactttactatgatgaatttgccaacctgatccaa
catgaaaagctggatccaaaagccctggaatgggttgggcataccatctgtaatgatttc
caggatgccttcgtagtggactcctgtgttgttccggaaggtgactttccatttcctgtg
aaagcactgtacggactggaagaatacgacactcaggatgggattgccataaacctcctg
ccgctgctgttttctcaggactttgcaaaagatgggggtccggtgacctcacaggaatca
ggccaaaaattggtgtctccgctgtgcctggctccgtatttccggttactgagactttgt
gtggagagacagcataacggaaacttggaggagattgatggtctactagattgtcctata
ttcctaactgacctggagcctggagagaagttggagtccatgtctgctaaagagcgttca
ttcatgtgttctctcatatttcttactctcaactggttccgagagattgtaaatgccttc
tgccaggaaacatcacctgagatgaaggggaaggtgctcactcggttaaagcacattgta
gaattgcaaataatcctggaaaagtacttggcagtcaccccagactatgtccctcctctt
ggaaactttgatgtggaaactttagatataacacctcatactgttactgctatttcagca
aaaatcagaaagaaaggaaaaatagaaaggaaacaaaaaacagatggcagcaagacatcc
tcctctgacacactttcagaagagaaaaattcagaatgtgaccctacgccatctcataga
ggccagctaaacaaggagttcacagggaaggaagaaaagacatcattgttactacataat
tcccatgcttttttccgagagctggacattgaggtcttctctattctacattgtggactt
gtgacgaagttcatcttagatactgaaatgcacactgaagctacagaagttgtgcaactt
gggccccctgagctgcttttcttgctggaagatctctcccagaagctggagagtatgctg
acacctcctattgccaggagagtcccctttctcaagaacaaaggaagccggaatattgga
ttctcacatctccaacagagatctgcccaagaaattgttcattgtgtttttcaactgctg
accccaatgtgtaaccacctggagaacattcacaactattttcagtgtttagctgctgag
aatcacggtgtagttgatggaccaggagtgaaagttcaggagtaccacataatgtcttcc
tgctatcagaggctgctgcagatttttcatgggctttttgcttggagtggattttctcaa
cctgaaaatcagaatttactgtattcagccctccatgtccttagtagccgactgaaacag
ggagaacacagccagcctttggaggaactactcagccagagcgtccattacttgcagaat
ttccatcaaagcattcccagtttccagtgtgctctttatctcatcagacttttgatggtt
attttggagaaatcaacagcttctgctcagaacaaagaaaaaattgcttcccttgccaga
caattcctctgtcgggtgtggccaagtggggataaagagaagagcaacatctctaatgac
cagctccatgctctgctctgtatctacctggagcacacagagagcattctgaaggccata
gaggagattgctggtgttggtgtcccagaactgatcaactctcctaaagatgcatcttcc
tccacattccctacactgaccaggcatacttttgttgttttcttccgtgtgatgatggct
gaactagagaagacggtgaaaaaaattgagcctggcacagcagcagactcgcagcagatt
catgaagagaaactcctctactggaacatggctgttcgagacttcagtatcctcatcaac
ttgataaaggtatttgatagtcatcctgttctgcatgtatgtttgaagtatgggcgtctc
tttgtggaagcatttctgaagcaatgtatgccgctcctagacttcagttttagaaaacac
cgggaagatgttctgagcttactggaaaccttccagttggacacaaggctgcttcatcac
ctgtgtgggcattccaagattcaccaggacacgagactcacccaacatgtgcctctgctc
aaaaagaccctggaacttttagtttgcagagtcaaagctatgctcactctcaacaattgt
agagaggctttctggctgggcaatctaaaaaaccgggacttgcagggtgaagagattaag
tcccaaaattcccaggagagcacagcagatgagagtgaggatgacatgtcatcccaggcc
tccaagagcaaagccactgaggatggtgaagaagacgaagtaagtgctggagaaaaggag
caagatagtgatgagagttatgatgactctgattag

DBGET integrated database retrieval system