KEGG   Homo sapiens (human): 218Help
Entry
218               CDS       T01001                                 

Gene name
ALDH3A1, ALDH3, ALDHIII
Definition
(RefSeq) aldehyde dehydrogenase 3 family member A1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    218 (ALDH3A1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    218 (ALDH3A1)
   00350 Tyrosine metabolism
    218 (ALDH3A1)
   00360 Phenylalanine metabolism
    218 (ALDH3A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    218 (ALDH3A1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    218 (ALDH3A1)
   00982 Drug metabolism - cytochrome P450
    218 (ALDH3A1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    218 (ALDH3A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     218 (ALDH3A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 218
NCBI-ProteinID: NP_000682
OMIM: 100660
HGNC: 405
Ensembl: ENSG00000108602
Vega: OTTHUMG00000059469
Pharos: P30838(Tchem)
UniProt: P30838 Q6PKA6
Structure
PDB: 

Position
17p11.2
AA seq 453 aa AA seqDB search
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcagcgaggccgtgaagcgcgcccgcgccgccttcagctcgggcaggacc
cgtccgctgcagttccggatccagcagctggaggcgctgcagcgcctgatccaggagcag
gagcaggagctggtgggcgcgctggccgcagacctgcacaagaatgaatggaacgcctac
tatgaggaggtggtgtacgtcctagaggagatcgagtacatgatccagaagctccctgag
tgggccgcggatgagcccgtggagaagacgccccagactcagcaggacgagctctacatc
cactcggagccactgggcgtggtcctcgtcattggcacctggaactaccccttcaacctc
accatccagcccatggtgggcgccatcgctgcagggaactcagtggtcctcaagccctcg
gagctgagtgagaacatggcgagcctgctggctaccatcatcccccagtacctggacaag
gatctgtacccagtaatcaatgggggtgtccctgagaccacggagctgctcaaggagagg
ttcgaccatatcctgtacacgggcagcacgggggtggggaagatcatcatgacggctgct
gccaagcacctgacccctgtcacgctggagctgggagggaagagtccctgctacgtggac
aagaactgtgacctggacgtggcctgccgacgcatcgcctgggggaaattcatgaacagt
ggccagacctgcgtggcccctgactacatcctctgtgacccctcgatccagaaccaaatt
gtggagaagctcaagaagtcactgaaagagttctacggggaagatgctaagaaatcccgg
gactatggaagaatcattagtgcccggcacttccagagggtgatgggcctgattgagggc
cagaaggtggcttatgggggcaccggggatgccgccactcgctacatagcccccaccatc
ctcacggacgtggacccccagtccccggtgatgcaagaggagatcttcgggcctgtgctg
cccatcgtgtgcgtgcgcagcctggaggaggccatccagttcatcaaccagcgtgagaag
cccctggccctctacatgttctccagcaacgacaaggtgattaagaagatgattgcagag
acatccagtggtggggtggcggccaacgatgtcatcgtccacatcaccttgcactctctg
cccttcgggggcgtggggaacagcggcatgggatcctaccatggcaagaagagcttcgag
actttctctcaccgccgctcttgcctggtgaggcctctgatgaatgatgaaggcctgaag
gtcagataccccccgagcccggccaagatgacccagcactga

KEGG   Homo sapiens (human): 220Help
Entry
220               CDS       T01001                                 

Gene name
ALDH1A3, ALDH1A6, ALDH6, MCOP8, RALDH3
Definition
(RefSeq) aldehyde dehydrogenase 1 family member A3
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Disease
H01027  Microphthalmia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    220 (ALDH1A3)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    220 (ALDH1A3)
   00350 Tyrosine metabolism
    220 (ALDH1A3)
   00360 Phenylalanine metabolism
    220 (ALDH1A3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    220 (ALDH1A3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    220 (ALDH1A3)
   00982 Drug metabolism - cytochrome P450
    220 (ALDH1A3)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    220 (ALDH1A3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     220 (ALDH1A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF658
Motif
Other DBs
NCBI-GeneID: 220
NCBI-ProteinID: NP_000684
OMIM: 600463
HGNC: 409
Ensembl: ENSG00000184254
Vega: OTTHUMG00000186439
Pharos: P47895(Tbio)
UniProt: P47895 A0A024RC95
Structure
PDB: 

Position
15q26.3
AA seq 512 aa AA seqDB search
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgctaacggggccgtggaaaacgggcagccggacaggaagccgccggccctg
ccgcgccccatccgcaacctggaggtcaagttcaccaagatatttatcaacaatgaatgg
cacgaatccaagagtgggaaaaagtttgctacatgtaacccttcaactcgggagcaaata
tgtgaagtggaagaaggagataagcccgacgtggacaaggctgtggaggctgcacaggtt
gccttccagaggggctcgccatggcgccggctggatgccctgagtcgtgggcggctgctg
caccagctggctgacctggtggagagggaccgcgccaccttggccgccctggagacgatg
gatacagggaagccatttcttcatgcttttttcatcgacctggagggctgtattagaacc
ctcagatactttgcagggtgggcagacaaaatccagggcaagaccatccccacagatgac
aacgtcgtgtgcttcaccaggcatgagcccattggtgtctgtggggccatcactccatgg
aacttccccctgctgatgctggtgtggaagctggcacccgccctctgctgtgggaacacc
atggtcctgaagcctgcggagcagacacctctcaccgccctttatctcggctctctgatc
aaagaggccgggttccctccaggagtggtgaacattgtgccaggattcgggcccacagtg
ggagcagcaatttcttctcaccctcagatcaacaagatcgccttcaccggctccacagag
gttggaaaactggttaaagaagctgcgtcccggagcaatctgaagcgggtgacgctggag
ctgggggggaagaacccctgcatcgtgtgtgcggacgctgacttggacttggcagtggag
tgtgcccatcagggagtgttcttcaaccaaggccagtgttgcacggcagcctccagggtg
ttcgtggaggagcaggtctactctgagtttgtcaggcggagcgtggagtatgccaagaaa
cggcccgtgggagaccccttcgatgtcaaaacagaacaggggcctcagattgatcaaaag
cagttcgacaaaatcttagagctgatcgagagtgggaagaaggaaggggccaagctggaa
tgcgggggctcagccatggaagacaaggggctcttcatcaaacccactgtcttctcagaa
gtcacagacaacatgcggattgccaaagaggagattttcgggccagtgcaaccaatactg
aagttcaaaagtatcgaagaagtgataaaaagagcgaatagcaccgactatggactcaca
gcagccgtgttcacaaaaaatctcgacaaagccctgaagttggcttctgccttagagtct
ggaacggtctggatcaactgctacaacgccctctatgcacaggctccatttggtggcttt
aaaatgtcaggaaatggcagagaactaggtgaatacgctttggccgaatacacagaagtg
aaaactgtcaccatcaaacttggcgacaagaacccctga

KEGG   Homo sapiens (human): 221Help
Entry
221               CDS       T01001                                 

Gene name
ALDH3B1, ALDH4, ALDH7
Definition
(RefSeq) aldehyde dehydrogenase 3 family member B1
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    221 (ALDH3B1)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    221 (ALDH3B1)
   00350 Tyrosine metabolism
    221 (ALDH3B1)
   00360 Phenylalanine metabolism
    221 (ALDH3B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    221 (ALDH3B1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    221 (ALDH3B1)
   00982 Drug metabolism - cytochrome P450
    221 (ALDH3B1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    221 (ALDH3B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     221 (ALDH3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 221
NCBI-ProteinID: NP_000685
OMIM: 600466
HGNC: 410
Ensembl: ENSG00000006534
Vega: OTTHUMG00000154910
Pharos: P43353(Tbio)
UniProt: P43353 A0A024R5D8
Position
11q13.2
AA seq 468 aa AA seqDB search
MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESE
VSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREK
PLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFD
TFSHHRACLLRSPGMEKLNALRYPPQSPRRLRMLLVAMEAQGCSCTLL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggacccccttggggacacgctgcggcgactgcgggaggccttccacgcggggcgcacg
cggccagctgagttccgggctgcgcagctccaaggcctgggccgcttcctgcaagaaaac
aagcagcttctgcacgacgcactggcccaggacctgcacaagtcagccttcgagtcggag
gtgtctgaggttgccatcagccagggcgaggtcaccctggccctcaggaacctccgggcc
tggatgaaggacgagcgtgtgcccaagaacctggccacgcagctggactccgccttcatc
cggaaggagccctttggcctggtcctcatcattgcgccctggaactatccgctgaacctg
acgctggtgcccctcgtgggagccctcgctgcagggaactgtgtggtgctgaagccatcg
gagattagcaagaacgtcgagaagatcctggccgaggtgctgccccaatacgtggaccag
agctgctttgctgtggtgctgggcgggccccaggagacggggcagctgctagagcacagg
ttcgactacatcttcttcacagggagccctcgtgtgggcaagattgttatgactgctgcc
gccaagcacctgacacctgtcaccctggagctggggggcaagaacccttgctacgtggac
gacaactgcgacccccagaccgtggccaaccgcgtggcctggttccgctacttcaacgcc
ggccagacctgcgtggcccccgactacgtcctatgcagccctgagatgcaggagaggctg
ctgcctgccctgcagagcaccatcacccgtttctatggcgacgacccccagagctcccca
aacctgggccgcatcatcaaccagaaacagttccagcggctgcgggcattgctgggctgc
ggccgtgtggccattgggggccagagcgatgagagcgatcgctacatcgcccccacggtg
ctggtggatgtgcaggagatggagcctgtgatgcaggaggagatcttcgggcccatcctg
cccatcgtgaacgtgcagagcttggacgaggccatcgagttcatcaaccggcgggagaag
cccctggccctgtacgccttctccaacagcagccaggtggtcaagcgggtgctgacccag
accagcagcgggggcttctgtgggaacgacggcttcatgcacatgaccctggccagcctg
ccttttggaggagtgggtgccagtgggatgggccggtaccatggcaagttctccttcgac
accttctcccaccatcgcgcctgcctcctgcgcagcccggggatggagaagctcaacgcc
ctccgctacccgccgcaatcgccgcgccgcctgaggatgctgctggtggccatggaggcc
caaggctgcagctgcacactgctctga

KEGG   Homo sapiens (human): 222Help
Entry
222               CDS       T01001                                 

Gene name
ALDH3B2, ALDH8
Definition
(RefSeq) aldehyde dehydrogenase 3 family member B2
  KO
K00129  aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00340  Histidine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    222 (ALDH3B2)
  09105 Amino acid metabolism
   00340 Histidine metabolism
    222 (ALDH3B2)
   00350 Tyrosine metabolism
    222 (ALDH3B2)
   00360 Phenylalanine metabolism
    222 (ALDH3B2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    222 (ALDH3B2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    222 (ALDH3B2)
   00982 Drug metabolism - cytochrome P450
    222 (ALDH3B2)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    222 (ALDH3B2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     222 (ALDH3B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 222
NCBI-ProteinID: NP_001026786
OMIM: 601917
HGNC: 411
Ensembl: ENSG00000132746
Vega: OTTHUMG00000167284
Pharos: P48448(Tdark)
Position
11q13.2
AA seq 385 aa AA seqDB search
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSE
ISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAAT
KHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLL
PALQSTITRFYGDDPQSSPNLGHIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVL
VDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKPLALYAFSNSSQVVNQMLERT
SSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEI
HYPPYTDWNQQLLRWGMGSQSCTLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatgaaccacggtccacgaacctgttcatgaagctggactcggtcttcatctgg
aaggaaccctttggcctggtcctcatcatcgcaccctggaactacccactgaacctgacc
ctggtgctcctggtgggcgccctcgccgcagggagttgcgtggtgctgaagccgtcagaa
atcagccagggcacagagaaggtcctggctgaggtgctgccccagtacctggaccagagc
tgctttgccgtggtgctgggcggaccccaggagacagggcagctgctagagcacaagttg
gactacatcttcttcacagggagccctcgtgtgggcaagattgtcatgactgctgccacc
aagcacctgacgcctgtcaccctggagctggggggcaagaacccctgctacgtggacgac
aactgcgacccccagaccgtggccaaccgcgtggcctggttctgctacttcaatgccggc
cagacctgcgtggcccctgactacgtcctgtgcagccccgagatgcaggagaggctgctg
cccgccctgcagagcaccatcacccgtttctatggcgacgacccccagagctccccaaac
ctgggccacatcatcaaccagaaacagttccagcggctgcgggcattgctgggctgcggc
cgcgtggccattgggggccagagcaacgagagcgatcgctacatcgcccccacggtgctg
gtggacgtgcaggagacggagcctgtgatgcaggaggagatcttcgggcccatcctgccc
atcgtgaacgtgcagagcgtggacgaggccatcaagttcatcaaccggcaggagaagccc
ctggccctgtacgccttctccaacagcagccaggttgtgaaccagatgctggagcggacc
agcagcggcagctttggaggcaatgagggcttcacctacatatctctgctgtccgtgcca
ttcgggggagtcggccacagtgggatgggccggtaccacggcaagttcaccttcgacacc
ttctcccaccaccgcacctgcctgctcgccccctccggcctggagaaattaaaggagatc
cactacccaccctataccgactggaaccagcagctgttacgctggggcatgggctcccag
agctgcaccctcctgtga

DBGET integrated database retrieval system