KEGG   Homo sapiens (human): 2180Help
Entry
2180              CDS       T01001                                 

Gene name
ACSL1, ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Definition
(RefSeq) acyl-CoA synthetase long chain family member 1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    2180 (ACSL1)
   00071 Fatty acid degradation
    2180 (ACSL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    2180 (ACSL1)
  09143 Cell growth and death
   04216 Ferroptosis
    2180 (ACSL1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    2180 (ACSL1)
   03320 PPAR signaling pathway
    2180 (ACSL1)
  09159 Environmental adaptation
   04714 Thermogenesis
    2180 (ACSL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    2180 (ACSL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2180 (ACSL1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2180 (ACSL1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2180 (ACSL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2180 (ACSL1)
  Exosomal proteins of breast cancer cells
   2180 (ACSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2180
NCBI-ProteinID: NP_001273637
OMIM: 152425
HGNC: 3569
Ensembl: ENSG00000151726
Vega: OTTHUMG00000160547
Pharos: P33121(Tbio)
UniProt: P33121 A8K9T3
Position
4q35.1
AA seq 698 aa AA seqDB search
MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQ
SVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEW
LSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDT
LGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQR
CGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRNIVSDCSAF
VKATENTVNPCPDDTLISFLPLAHMFERVVECVMLCHGAKIGFFQGDIRLLMDDLKVLQP
TVFPVVPRLLNRMFDRIFGQANTTLKRWLLDFASKRKEAELRSGIIRNNSLWDRLIFHKV
QSSLGGRVRLMVTGAAPVSATVLTFLRAALGCQFYEGYGQTECTAGCCLTMPGDWTAGHV
GAPMPCNLIKLVDVEEMNYMAAEGEGEVCVKGPNVFQGYLKDPAKTAEALDKDGWLHTGD
IGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYMRSEPVAQVFVHGESLQAFLIAI
VVPDVETLCSWAQKRGFEGSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHP
ELFSIDNGLLTPTMKAKRPELRNYFRSQIDDLYSTIKV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcccatgagctgttccggtattttcgaatgccagagctggttgacttccgacag
tacgtgcgtactcttccgaccaacacgcttatgggcttcggagcttttgcagcactcacc
accttctggtacgccacgagacccaaacccctgaagccgccatgcgacctctccatgcag
tcagtggaagtggcgggtagtggtggtgcacgaagatccgcactacttgacagcgacgag
cccttggtgtatttctatgatgatgtcacaacattatacgaaggtttccagaggggaata
caggtgtcaaataatggcccttgtttaggctctcggaaaccagaccaaccctatgaatgg
ctttcatataaacaggttgcagaattgtcggagtgcataggctcagcactgatccagaag
ggcttcaagactgccccagatcagttcattggcatctttgctcaaaatagacctgagtgg
gtgattattgaacaaggatgctttgcttattcgatggtgatcgttccactttatgatacc
cttggaaatgaagccatcacgtacatagtcaacaaagctgaactctctctggtttttgtt
gacaagccagagaaggccaaactcttattagagggtgtagaaaataagttaataccaggc
cttaaaatcatagttgtcatggatgcctacggcagtgaactggtggaacgaggccagagg
tgtggggtggaagtcaccagcatgaaggcgatggaggacctgggaagagccaacagacgg
aagcccaagcctccagcacctgaagatcttgcagtaatttgtttcacaagtggaactaca
ggcaaccccaaaggagcaatggtcactcaccgaaacatagtgagcgattgttcagctttt
gtgaaagcaacagagaatacagtcaatccttgcccagatgatactttgatatctttcttg
cctctcgcccatatgtttgagagagttgtagagtgtgtaatgctgtgtcatggagctaaa
atcggatttttccaaggagatatcaggctgctcatggatgacctcaaggtgcttcaaccc
actgtcttccccgtggttccaagactgctgaaccggatgtttgaccgaattttcggacaa
gcaaacaccacgctgaagcgatggctcttggactttgcctccaagaggaaagaagcagag
cttcgcagcggcatcatcagaaacaacagcctgtgggaccggctgatcttccacaaagta
cagtcgagcctgggcggaagagtccggctgatggtgacaggagccgccccggtgtctgcc
actgtgctgacgttcctcagagcagccctgggctgtcagttttatgaaggatacggacag
acagagtgcactgccgggtgctgcctgaccatgcctggagactggaccgcaggccatgtt
ggggccccgatgccgtgcaatttgataaaacttgttgatgtggaagaaatgaattacatg
gctgccgagggcgagggcgaggtgtgtgtgaaagggccaaatgtatttcagggctacttg
aaggacccagcgaaaacagcagaagctttggacaaagacggctggttacacacaggggac
attggaaaatggttaccaaatggcaccttgaaaattatcgaccggaaaaagcacatattt
aagctggcacaaggagaatacatagcccctgaaaagattgaaaatatctacatgcgaagt
gagcctgttgctcaggtgtttgtccacggagaaagcctgcaggcatttctcattgcaatt
gtggtaccagatgttgagacattatgttcctgggcccaaaagagaggatttgaagggtcg
tttgaggaactgtgcagaaataaggatgtcaaaaaagctatcctcgaagatatggtgaga
cttgggaaggattctggtctgaaaccatttgaacaggtcaaaggcatcacattgcaccct
gaattattttctatcgacaatggccttctgactccaacaatgaaggcgaaaaggccagag
ctgcggaactatttcaggtcgcagatagatgacctctattccactatcaaggtttag

KEGG   Homo sapiens (human): 2181Help
Entry
2181              CDS       T01001                                 

Gene name
ACSL3, ACS3, FACL3, LACS_3, LACS3, PRO2194
Definition
(RefSeq) acyl-CoA synthetase long chain family member 3
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    2181 (ACSL3)
   00071 Fatty acid degradation
    2181 (ACSL3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    2181 (ACSL3)
  09143 Cell growth and death
   04216 Ferroptosis
    2181 (ACSL3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    2181 (ACSL3)
   03320 PPAR signaling pathway
    2181 (ACSL3)
  09159 Environmental adaptation
   04714 Thermogenesis
    2181 (ACSL3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    2181 (ACSL3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2181 (ACSL3)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2181 (ACSL3)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2181 (ACSL3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2181 (ACSL3)
  Exosomal proteins of breast cancer cells
   2181 (ACSL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2181
NCBI-ProteinID: NP_004448
OMIM: 602371
HGNC: 3570
Ensembl: ENSG00000123983
Vega: OTTHUMG00000133160
Pharos: O95573(Tbio)
UniProt: O95573 A0A024R497
Position
2q36.1
AA seq 720 aa AA seqDB search
MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPV
NSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPN
GKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACF
MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGK
PPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMIS
HSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGYSSPQTLADQ
SSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI
SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTES
AGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYY
KNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAA
LKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLK
VLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgaataaccacgtgtcttcaaaaccatctaccatgaagctaaaacataccatcaaccct
attcttttatattttatacattttctaatatcactttatactattttaacatacattccg
ttttattttttctccgagtcaagacaagaaaaatcaaaccgaattaaagcaaagcctgta
aattcaaaacctgattctgcatacagatctgttaatagtttggatggtttggcttcagta
ttataccctggatgtgatactttagataaagtttttacatatgcaaaaaacaaatttaag
aacaaaagactcttgggaacacgtgaagttttaaatgaggaagatgaagtacaaccaaat
ggaaaaatttttaaaaaggttattcttggacagtataattggctttcctatgaagatgtc
tttgttcgagcctttaattttggaaatggattacagatgttgggtcagaaaccaaagacc
aacatcgccatcttctgtgagaccagggccgagtggatgatagctgcacaggcgtgtttt
atgtataattttcagcttgttacattatatgccactctaggaggtccagccattgttcat
gcattaaatgaaacagaggtgaccaacatcattactagtaaagaactcttacaaacaaag
ttgaaggatatagtttctttggtcccacgcctgcggcacatcatcactgttgatggaaag
ccaccgacctggtccgagttccccaagggcatcattgtgcataccatggctgcagtggag
gccctgggagccaaggccagcatggaaaaccaacctcatagcaaaccattgccctcagat
attgcagtaatcatgtacacaagtggatccacaggacttccaaagggagtcatgatctca
catagtaacattattgctggtataactgggatggcagaaaggattccagaactaggagag
gaagatgtctacattggatatttgcctctggcccatgttctagaattaagtgctgagctt
gtctgtctttctcacggatgccgcattggttactcttcaccacagactttagcagatcag
tcttcaaaaattaaaaaaggaagcaaaggggatacatccatgttgaaaccaacactgatg
gcagcagttccggaaatcatggatcggatctacaaaaatgtcatgaataaagtcagtgaa
atgagtagttttcaacgtaatctgtttattctggcctataattacaaaatggaacagatt
tcaaaaggacgtaatactccactgtgcgacagctttgttttccggaaagttcgaagcttg
ctagggggaaatattcgtctcctgttgtgtggtggcgctccactttctgcaaccacgcag
cgattcatgaacatctgtttctgctgtcctgttggtcagggatacgggctcactgaatct
gctggggctggaacaatttccgaagtgtgggactacaatactggcagagtgggagcacca
ttagtttgctgtgaaatcaaattaaaaaactgggaggaaggtggatactttaatactgat
aagccacaccccaggggtgaaattcttattgggggccaaagtgtgacaatggggtactac
aaaaatgaagcaaaaacaaaagctgatttctttgaagatgaaaatggacaaaggtggctc
tgtactggggatattggagagtttgaacccgatggatgcttaaagattattgatcgtaaa
aaggaccttgtaaaactacaggcaggggaatatgtttctcttgggaaagtagaggcagct
ttgaagaatcttccactagtagataacatttgtgcatatgcaaacagttatcattcttat
gtcattggatttgttgtgccaaatcaaaaggaactaactgaactagctcgaaagaaagga
cttaaagggacttgggaggagctgtgtaacagttgtgaaatggaaaatgaggtacttaaa
gtgctttccgaagctgctatttcagcaagtctggaaaagtttgaaattccagtaaaaatt
cgtttgagtcctgaaccgtggacccctgaaactggtctggtgacagatgccttcaagctg
aaacgcaaagagcttaaaacacattaccaggcggacattgagcgaatgtatggaagaaaa
taa

KEGG   Homo sapiens (human): 2182Help
Entry
2182              CDS       T01001                                 

Gene name
ACSL4, ACS4, FACL4, LACS4, MRX63, MRX68
Definition
(RefSeq) acyl-CoA synthetase long chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    2182 (ACSL4)
   00071 Fatty acid degradation
    2182 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    2182 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    2182 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    2182 (ACSL4)
   03320 PPAR signaling pathway
    2182 (ACSL4)
  09159 Environmental adaptation
   04714 Thermogenesis
    2182 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    2182 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2182 (ACSL4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2182 (ACSL4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2182 (ACSL4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2182 (ACSL4)
  Exosomal proteins of breast cancer cells
   2182 (ACSL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 2182
NCBI-ProteinID: NP_001305438
OMIM: 300157
HGNC: 3571
Ensembl: ENSG00000068366
Vega: OTTHUMG00000022190
Pharos: O60488(Tbio)
UniProt: O60488
Position
Xq23
AA seq 711 aa AA seqDB search
MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPE
GFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaagctaaatgtgctcaccattattttgctgcctgtccacttgttaataaca
atatacagtgcccttatatttattccatggtattttcttaccaatgccaagaagaaaaac
gctatggcaaagagaataaaagctaagcccacttcagacaaacctggaagtccatatcgc
tctgtcacacacttcgactcactagctgtaatagacatccctggagcagatactctggat
aaattatttgaccatgctgtatccaagtttgggaagaaggacagccttgggaccagggaa
atcctaagtgaagaaaatgaaatgcagccaaatggaaaagtttttaagaagttaattctt
gggaattataaatggatgaactatcttgaagtgaatcgcagagtgaataactttggtagt
ggactcactgcactgggactaaaaccaaagaacaccattgccatcttctgtgagaccagg
gccgaatggatgattgcagcacagacctgctttaagtacaactttcctcttgtgacttta
tatgccacacttggcaaagaagcagtagttcatgggctaaatgaatctgaggcttcctat
ctgattaccagtgttgaacttctggaaagtaaacttaagactgcattgttagatatcagt
tgtgttaaacatatcatttatgtggacaataaggctatcaataaagcagagtaccctgaa
ggatttgagattcacagcatgcaatcagtagaagagttgggatctaacccagaaaacttg
ggcattcctccaagtagaccaacgccttcagacatggccattgttatgtatactagtggt
tctactggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgaca
ggccagtgtgaaagaatacctggactgggaccgaaggacacatatattggctacttgcct
ttggctcatgtgctagaactgacagcagagatatcttgctttacctatggctgcaggatt
ggatattcttctccgcttacactctctgaccagtccagcaaaattaaaaaaggaagcaaa
ggagactgtactgtactgaagcccacacttatggctgctgttccggaaatcatggataga
atttataagaatgttatgagcaaagtccaagagatgaattatattcagaaaactctgttc
aagatagggtatgattacaaattggaacagatcaaaaagggatatgatgcacctctttgc
aatctgttactgtttaaaaaggtcaaggccctgctgggagggaatgtccgcatgatgctg
tctggaggggccccgctatctcctcagacacaccgattcatgaatgtctgcttctgctgc
ccaattggccagggttatggactgacagaatcatgtggtgctgggacagttactgaagta
actgactatactactggcagagttggagcacctcttatttgctgtgaaattaagctaaaa
gactggcaagaaggcggttatacaattaatgacaagccaaaccccagaggtgaaatcgta
attggtggacagaacatctccatgggatattttaaaaatgaagagaaaacagcagaagat
tattctgtggatgaaaatggacaaaggtggttttgcactggtgatattggagaattccat
cccgatggatgtttacagattatagatcgtaagaaagatctagtgaagttacaagcagga
gagtatgtatctcttgggaaagtagaagctgcactgaagaattgtccacttattgacaac
atctgtgcttttgccaaaagtgatcagtcctatgtgatcagttttgtggttcctaaccag
aaaaggttgacacttttggcacaacagaaaggggtagaaggaacttgggttgatatctgc
aataatcctgctatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatg
aaattggagcgatttgaaattccaatcaaggttcgattaagcccagagccatggacccct
gaaactggtttggtaactgatgctttcaaactgaaaaggaaggagctgaggaaccattac
ctcaaagacattgaacgaatgtatgggggcaaataa

KEGG   Homo sapiens (human): 23205Help
Entry
23205             CDS       T01001                                 

Gene name
ACSBG1, BG, BG1, BGM, GR-LACS, LPD
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    23205 (ACSBG1)
   00071 Fatty acid degradation
    23205 (ACSBG1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    23205 (ACSBG1)
   03320 PPAR signaling pathway
    23205 (ACSBG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    23205 (ACSBG1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23205 (ACSBG1)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23205 (ACSBG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding IFT20
Motif
Other DBs
NCBI-GeneID: 23205
NCBI-ProteinID: NP_055977
OMIM: 614362
HGNC: 29567
Ensembl: ENSG00000103740
Vega: OTTHUMG00000143734
Pharos: Q96GR2(Tbio)
UniProt: Q96GR2 B3KNS7
Position
15q25.1
AA seq 724 aa AA seqDB search
MPRNSGAGYGCPHGDPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHA
LELSVPEKVNNAQWDAPEEALWTTRADGRVRLRIDPSCPQLPYTVHRMFYEALDKYGDLI
ALGFKRQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFA
GGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPP
NKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNIT
WTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSL
VNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDL
KPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETS
GPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAI
DEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLI
GDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQA
IEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ
EQKM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcaattctggagctggatacggctgcccacacggggaccccagcatgctggac
agcagagagaccccacaggagagccggcaggacatgattgtgaggaccacccaagaaaaa
ttgaaaaccagctcactgactgacaggcagccactctccaaagagtccctgaaccatgct
ctcgagctctcagtgccagagaaggtgaataatgcccagtgggatgctccagaggaggcg
ctgtggacgactcgggccgatgggcgggtgcgcctgcgcatagaccccagctgcccacag
cttccctacactgtgcatcggatgttctacgaggccctggataagtatggggacctcatc
gctttgggcttcaagcgccaggacaagtgggaacacatctcctactcccaatactacctg
ctcgcccgcagagccgccaagggcttcctgaagctcggcctgaagcaggcccacagtgtg
gccatcctcggcttcaactccccggagtggttcttctcggcagtgggcacagtatttgca
ggtggcatcgtcactggcatctacaccaccagctccccagaggcctgccagtacatcgct
tatgactgctgcgccaatgtcatcatggtcgacacgcagaagcagctggaaaagatcctg
aagatctggaaacagttgccacatctaaaggcagtcgtgatatataaagaacctcctcca
aacaagatggccaatgtgtacacgatggaggaattcatggagctggggaatgaagtgcct
gaggaagccctggacgccatcattgacacccagcagcccaaccagtgctgtgtgctagtc
tacacttccggcaccactgggaaccccaagggcgtgatgctgagtcaagacaatatcacg
tggacggcacggtacggcagccaggccggtgacatccggccggcagaagtccagcaggag
gtggtagtcagctacctgcccctcagccatattgccgcccagatctacgacctgtggaca
ggcatccagtggggggcccaggtttgctttgccgaacccgacgccctgaaggggagcctg
gtgaacacgctgcgggaggtggagcccacatcacacatgggggtgccccgggtatgggag
aagatcatggagcgcatccaggaggtggcggctcagtctggcttcatccggcgaaagatg
ctgctgtgggccatgtcggtgaccttggagcagaacctcacctgccccggcagcgacctg
aagcccttcacaaccagactggcagattacctggtgctagccaaggttcgccaggcactg
ggatttgccaagtgtcaaaagaacttctatggagcggcccccatgatggcagagacacag
cacttcttcctgggtctcaacatccgcttgtatgcgggctacggcctcagtgagacctca
ggcccccacttcatgtccagtccctacaactaccggctgtacagctcaggcaagttggtg
cccggctgtcgggtgaagctggtgaaccaggacgcagagggcattggcgagatctgcctg
tggggccgcaccatattcatgggctacctgaacatggaggacaagacttgtgaggccatc
gacgaggaaggctggctgcacacgggtgatgctggccgcctggacgccgatggcttcctc
tacatcactgggcgcctcaaagaattaatcatcacagctggtggggagaatgtgccccct
gtgcccatcgaggaggccgtgaagatggagctgcccatcatcagcaacgccatgctcatt
ggggaccagaggaagttcctgtccatgctgctcaccttgaagtgcactctggacccagac
acctctgaccagactgataatctgactgaacaagctatggagttctgccagagggtgggc
agcagagccaccacagtgtccgagatcatagagaagaaggatgaggccgtgtaccaggcc
atcgaagaggggatccggagggtcaacatgaacgcggcggcccggccctaccacatccag
aagtgggccattctcgagagagacttctccatttcgggtggagagttgggtcccacgatg
aaactgaaacggctcacagttttggagaagtacaaaggtatcattgactccttttaccaa
gagcaaaaaatgtaa

KEGG   Homo sapiens (human): 23305Help
Entry
23305             CDS       T01001                                 

Gene name
ACSL6, ACS2, FACL6, LACS_6, LACS2, LACS5
Definition
(RefSeq) acyl-CoA synthetase long chain family member 6
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    23305 (ACSL6)
   00071 Fatty acid degradation
    23305 (ACSL6)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    23305 (ACSL6)
  09143 Cell growth and death
   04216 Ferroptosis
    23305 (ACSL6)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    23305 (ACSL6)
   03320 PPAR signaling pathway
    23305 (ACSL6)
  09159 Environmental adaptation
   04714 Thermogenesis
    23305 (ACSL6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    23305 (ACSL6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23305 (ACSL6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23305 (ACSL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23305 (ACSL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   23305 (ACSL6)
  Exosomal proteins of breast cancer cells
   23305 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 23305
NCBI-ProteinID: NP_001192177
OMIM: 604443
HGNC: 16496
Ensembl: ENSG00000164398
Vega: OTTHUMG00000150692
Pharos: Q9UKU0(Tbio)
UniProt: Q9UKU0 B2RB13
Position
5q31.1
AA seq 697 aa AA seqDB search
MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQ
SEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQW
LSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDT
LGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQK
CGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGF
LKVTESQWAPTCADVHISYLPLAHMFERMVQSVVYCHGGRVGFFQGDIRLLSDDMKALCP
TIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHV
GAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGD
IGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGI
VVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHS
DMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacaggagatcctgaggatactgcgactgcctgagctaggtgacttgggacag
tttttccgcagcctctcggccaccaccctcgtgagtatgggtgccctggctgccatcctt
gcctactggttcactcaccggccaaaggccttgcagccgccatgcaacctcctgatgcag
tcagaagaagtagaggacagtggcggggcacggcgatctgtgattgggtctggccctcag
ctacttacccactactatgatgatgcccggaccatgtaccaggtgttccgccgtgggctt
agcatctcagggaatgggccctgtcttggtttcaggaagcctaagcagccttaccagtgg
ctgtcctaccaggaggtggccgacagggctgaatttctggggtccggacttctccagcac
aattgtaaagcatgcactgatcagtttattggtgtttttgcacaaaatcggccagagtgg
atcattgtggagctggcctgctacacatattccatggtggtggtcccgctctatgacacc
ctgggccctggggctatccgctacatcatcaatacagcggacatcagcaccgtgattgtg
gacaaacctcagaaggctgtgcttctgctagagcatgtggagaggaaggagactccaggc
ctcaagctgatcatcctcatggacccattcgaagaagccctgaaagagagagggcagaag
tgcggggtggtcattaagtccatgcaggccgtggaggactgtggccaagagaatcaccag
gctcctgtgcccccgcagcctgatgacctctccattgtgtgtttcacaagcggcacgaca
gggaacccaaaaggtgcgatgctcacccatgggaacgtggtggctgatttctcaggcttt
ctgaaagtgacagagagtcagtgggctcccacttgtgcggatgtgcacatttcctatttg
cctttagcacacatgtttgagcgaatggtgcagtctgtcgtctattgccacggagggcgt
gttggcttcttccagggagatatccgccttctctcagatgacatgaaggctctatgcccc
accatcttccctgtggtcccacgactgctgaaccggatgtacgacaagatcttcagccag
gcaaacacaccattaaagcgctggctcctggagtttgcagcaaagcgtaagcaagccgag
gtccggagtggaatcatcaggaatgatagtatctgggatgaactcttctttaataagatt
caggccagtcttggtgggtgtgtgcggatgattgttactggagcagccccagcatcacca
acagttctgggatttctccgggcagctctagggtgccaggtttatgaaggttatggccaa
actgagtgcacagctggatgtaccttcaccactcctggcgactggacctcagggcacgta
ggggcgccacttccctgcaatcatatcaagctcgttgatgttgaggaactgaactactgg
gcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtgttcaaaggctacttg
aaagatccagacaggacgaaggaggccctggacagcgatggctggcttcacactggagac
atcggaaaatggctgccggcaggaactcttaaaattattgatcggaaaaagcatatattt
aaacttgctcagggagaatatgttgcacccgagaagattgagaacatctacatccggagc
caacctgtggcgcaaatctatgtccatggggacagcttaaaggcctttttggtaggcatt
gttgtgcctgaccctgaagttatgccctcctgggcccagaagagaggaattgaaggaaca
tatgcagatctctgcacaaataaggatctgaagaaagccattttggaagatatggtgagg
ttaggaaaagaaagtggactccattcttttgagcaggttaaagccattcacatccattct
gacatgttctcagttcaaaatggcttgctgacaccaacactaaaagctaagagacctgag
ctgagagagtacttcaaaaaacaaatagaagagctttactcaatctccatgtga

KEGG   Homo sapiens (human): 51703Help
Entry
51703             CDS       T01001                                 

Gene name
ACSL5, ACS2, ACS5, FACL5
Definition
(RefSeq) acyl-CoA synthetase long chain family member 5
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    51703 (ACSL5)
   00071 Fatty acid degradation
    51703 (ACSL5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    51703 (ACSL5)
  09143 Cell growth and death
   04216 Ferroptosis
    51703 (ACSL5)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    51703 (ACSL5)
   03320 PPAR signaling pathway
    51703 (ACSL5)
  09159 Environmental adaptation
   04714 Thermogenesis
    51703 (ACSL5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    51703 (ACSL5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51703 (ACSL5)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     51703 (ACSL5)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   51703 (ACSL5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51703 (ACSL5)
  Exosomal proteins of breast cancer cells
   51703 (ACSL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 51703
NCBI-ProteinID: NP_976313
OMIM: 605677
HGNC: 16526
Ensembl: ENSG00000197142
Vega: OTTHUMG00000019060
Pharos: Q9ULC5(Tbio)
UniProt: Q9ULC5
Position
10q25.2
AA seq 683 aa AA seqDB search
MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVS
QKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGS
CLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADI
AMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLG
KEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDV
AISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYD
KVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGA
APMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVA
DMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDR
KKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKL
GVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLK
AKRGELSKYFRTQIDSLYEHIQD
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctttttatctttaactttttgttttccccacttccgaccccggcgttgatctgcatc
ctgacatttggagctgccatcttcttgtggctgatcaccagacctcaacccgtcttacct
cttcttgacctgaacaatcagtctgtgggaattgagggaggagcacggaagggggtttcc
cagaagaacaatgacctaacaagttgctgcttctcagatgccaagactatgtatgaggtt
ttccaaagaggactcgctgtgtctgacaatgggccctgcttgggatatagaaaaccaaac
cagccctacagatggctatcttacaaacaggtgtctgatagagcagagtacctgggttcc
tgtctcttgcataaaggttataaatcatcaccagaccagtttgtcggcatctttgctcag
aataggccagagtggatcatctccgaattggcttgttacacgtactctatggtagctgta
cctctgtatgacaccttgggaccagaagccatcgtacatattgtcaacaaggctgatatc
gccatggtgatctgtgacacaccccaaaaggcattggtgctgatagggaatgtagagaaa
ggcttcaccccgagcctgaaggtgatcatccttatggacccctttgatgatgacctgaag
caaagaggggagaagagtggaattgagatcttatccctatatgatgctgagaacctaggc
aaagagcacttcagaaaacctgtgcctcctagcccagaagacctgagcgtcatctgcttc
accagtgggaccacaggtgaccccaaaggagccatgataacccatcaaaatattgtttca
aatgctgctgcctttctcaaatgtgtggagcatgcttatgagcccactcctgatgatgtg
gccatatcctacctccctctggctcatatgtttgagaggattgtacaggctgttgtgtac
agctgtggagccagagttggattcttccaaggggatattcggttgctggctgacgacatg
aagactttgaagcccacattgtttcccgcggtgcctcgactccttaacaggatctacgat
aaggtacaaaatgaggccaagacacccttgaagaagttcttgttgaagctggctgtttcc
agtaaattcaaagagcttcaaaagggtatcatcaggcatgatagtttctgggacaagctc
atctttgcaaagatccaggacagcctgggcggaagggttcgtgtaattgtcactggagct
gcccccatgtccacttcagtcatgacattcttccgggcagcaatgggatgtcaggtgtat
gaagcttatggtcaaacagaatgcacaggtggctgtacatttacattacctggggactgg
acatcaggtcacgttggggtgcccctggcttgcaattacgtgaagctggaagatgtggct
gacatgaactactttacagtgaataatgaaggagaggtctgcatcaagggtacaaacgtg
ttcaaaggatacctgaaggaccctgagaagacacaggaagccctggacagtgatggctgg
cttcacacaggagacattggtcgctggctcccgaatggaactctgaagatcatcgaccgt
aaaaagaacattttcaagctggcccaaggagaatacattgcaccagagaagatagaaaat
atctacaacaggagtcaaccagtgttacaaatttttgtacacggggagagcttacggtca
tccttagtaggagtggtggttcctgacacagatgtacttccctcatttgcagccaagctt
ggggtgaagggctcctttgaggaactgtgccaaaaccaagttgtaagggaagccatttta
gaagacttgcagaaaattgggaaagaaagtggccttaaaacttttgaacaggtcaaagcc
atttttcttcatccagagccattttccattgaaaatgggctcttgacaccaacattgaaa
gcaaagcgaggagagctttccaaatactttcggacccaaattgacagcctgtatgagcac
atccaggattag

KEGG   Homo sapiens (human): 81616Help
Entry
81616             CDS       T01001                                 

Gene name
ACSBG2, BGR, BRGL, PRTD-NY3, PRTDNY3
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    81616 (ACSBG2)
   00071 Fatty acid degradation
    81616 (ACSBG2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    81616 (ACSBG2)
   03320 PPAR signaling pathway
    81616 (ACSBG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    81616 (ACSBG2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     81616 (ACSBG2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   81616 (ACSBG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Motif
Other DBs
NCBI-GeneID: 81616
NCBI-ProteinID: NP_001276106
OMIM: 614363
HGNC: 24174
Ensembl: ENSG00000130377
Vega: OTTHUMG00000180754
Pharos: Q5FVE4(Tbio)
UniProt: Q5FVE4 A0A140VJD4
Position
19p13.3
AA seq 666 aa AA seqDB search
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRES
VNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFI
TAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKA
IIQYRLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGV
MLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKK
MLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESET
ETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPII
SNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQ
IDHMYH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccccaaagactcaagaaggagctaaagatcttgaagtagacatgaataaa
acagaagttactcccaggctgtggaccacctgtcgagatggagaagtccttctgaggcta
tccaaacacggaccaggccatgagaccccgatgaccatccctgaattttttcgagagtca
gtcaaccgatttggaacttatccagccctcgcatccaagaatggcaaaaagtgggaaatt
ctgaatttcaaccagtactatgaggcttgtcggaaggctgcaaaatccttgatcaagctg
ggtttggagcgtttccacggagttggtatcctggggtttaactctgcagagtggtttatc
actgctgttggtgccatcctagccgggggtctttgtgttggtatttatgccaccaactct
gccgaggtttgtcaatatgtcatcactcatgccaaagtgaacatcttgctggttgagaat
gatcaacagttacagaaaatcctttcgattccacagagcagcctagagcccctaaaagcg
atcatccagtacagactgccaatgaagaagaacaacaacttgtactcttgggatgatttc
atggaacttggcagaagtatccctgacacccaactggagcaggtcatcgagagccagaag
gcgaatcaatgcgcagtgctcatctacacttcagggaccacaggcatacccaagggagtg
atgctcagtcatgacaacatcacgtggattgcaggagcagtgacaaaggactttaaactg
acagacaagcatgagacggtggttagctacctcccactcagccatattgcagcacagatg
atggacatctgggtacccataaagattggggcgctcacatactttgctcaagcagatgct
ctcaagggcaccttggtaagtactctaaaggaggtaaaacctactgtcttcattggagtg
cctcaaatttgggagaagatacatgagatggtgaagaaaaatagtgccaagtccatgggc
ttgaagaagaaggcattcgtgtgggcaagaaacattggcttcaaggtcaactcaaaaaag
atgttggggaaatataatactcccgtgagctaccgcatggctaagactctcgtgttcagc
aaagtcaagacatcccttggcttggatcactgtcactcttttatcagtgggactgcgccc
ctcaaccaagagactgccgagttctttctaagcttggacatacctataggcgagttgtat
gggttgagtgagagctcgggaccccacacgatatccaaccagaataactacaggcttcta
agctgtggcaagatcttgactgggtgtaagaatatgctgttccagcagaacaaggatggc
attggggagatctgcctctggggtaggcacatcttcatgggctatctggaaagtgagact
gaaactacagaggccatcgatgatgaaggctggctacactctggggatctgggccagctg
gacggtctgggtttcctctatgtcaccggccacatcaaagaaatccttatcactgctggt
ggtgaaaatgtgccccccattcctgttgagaccttggttaagaagaagatccccatcatc
agtaacgccatgttagtaggagataaactgaagtttctgagcatgttgctgacgctgaag
tgtgagatgaatcagatgagcggagaacctctggacaagctgaacttcgaggccatcaac
ttctgtcggggtctgggcagccaggcatccaccgtgactgagattgtgaagcagcaagac
cccctggtctacaaggccatccagcaaggcatcaatgctgtgaaccaggaagccatgaac
aatgcacagaggattgaaaagtgggtcatcttggagaaggacttttccatctatggtgga
gagctaggtccaatgatgaaacttaagagacattttgtagcccagaaatacaaaaaacaa
attgatcacatgtaccactga

DBGET integrated database retrieval system