KEGG   Homo sapiens (human): 2182
Entry
2182              CDS       T01001                                 
Symbol
ACSL4, ACS4, FACL4, LACS4, MRX63, MRX68, XLID63
Name
(RefSeq) acyl-CoA synthetase long chain family member 4
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04146  Peroxisome
hsa04216  Ferroptosis
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Network
nt06020  beta-Oxidation in mitochondria
  Element
N00765  beta-Oxidation, acyl-CoA synthesis
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    2182 (ACSL4)
   00071 Fatty acid degradation
    2182 (ACSL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    2182 (ACSL4)
  09143 Cell growth and death
   04216 Ferroptosis
    2182 (ACSL4)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    2182 (ACSL4)
   03320 PPAR signaling pathway
    2182 (ACSL4)
  09159 Environmental adaptation
   04714 Thermogenesis
    2182 (ACSL4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    2182 (ACSL4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2182 (ACSL4)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     2182 (ACSL4)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   2182 (ACSL4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2182 (ACSL4)
  Exosomal proteins of breast cancer cells
   2182 (ACSL4)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 2182
NCBI-ProteinID: NP_001305438
OMIM: 300157
HGNC: 3571
Ensembl: ENSG00000068366
Pharos: O60488(Tbio)
UniProt: O60488
Position
X:complement(109641335..109733257)
AA seq 711 aa
MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYR
SVTHFDSLAVIDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLIL
GNYKWMNYLEVNRRVNNFGSGLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTL
YATLGKEAVVHGLNESEASYLITSVELLESKLKTALLDISCVKHIIYVDNKAINKAEYPE
GFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSGSTGRPKGVMMHHSNLIAGMT
GQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSDQSSKIKKGSK
GDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEV
TDYTTGRVGAPLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAED
YSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDN
ICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAM
KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgaaacttaagctaaatgtgctcaccattattttgctgcctgtccacttgttaataaca
atatacagtgcccttatatttattccatggtattttcttaccaatgccaagaagaaaaac
gctatggcaaagagaataaaagctaagcccacttcagacaaacctggaagtccatatcgc
tctgtcacacacttcgactcactagctgtaatagacatccctggagcagatactctggat
aaattatttgaccatgctgtatccaagtttgggaagaaggacagccttgggaccagggaa
atcctaagtgaagaaaatgaaatgcagccaaatggaaaagtttttaagaagttaattctt
gggaattataaatggatgaactatcttgaagtgaatcgcagagtgaataactttggtagt
ggactcactgcactgggactaaaaccaaagaacaccattgccatcttctgtgagaccagg
gccgaatggatgattgcagcacagacctgctttaagtacaactttcctcttgtgacttta
tatgccacacttggcaaagaagcagtagttcatgggctaaatgaatctgaggcttcctat
ctgattaccagtgttgaacttctggaaagtaaacttaagactgcattgttagatatcagt
tgtgttaaacatatcatttatgtggacaataaggctatcaataaagcagagtaccctgaa
ggatttgagattcacagcatgcaatcagtagaagagttgggatctaacccagaaaacttg
ggcattcctccaagtagaccaacgccttcagacatggccattgttatgtatactagtggt
tctactggccgacctaagggagtgatgatgcatcatagcaatttgatagctggaatgaca
ggccagtgtgaaagaatacctggactgggaccgaaggacacatatattggctacttgcct
ttggctcatgtgctagaactgacagcagagatatcttgctttacctatggctgcaggatt
ggatattcttctccgcttacactctctgaccagtccagcaaaattaaaaaaggaagcaaa
ggagactgtactgtactgaagcccacacttatggctgctgttccggaaatcatggataga
atttataagaatgttatgagcaaagtccaagagatgaattatattcagaaaactctgttc
aagatagggtatgattacaaattggaacagatcaaaaagggatatgatgcacctctttgc
aatctgttactgtttaaaaaggtcaaggccctgctgggagggaatgtccgcatgatgctg
tctggaggggccccgctatctcctcagacacaccgattcatgaatgtctgcttctgctgc
ccaattggccagggttatggactgacagaatcatgtggtgctgggacagttactgaagta
actgactatactactggcagagttggagcacctcttatttgctgtgaaattaagctaaaa
gactggcaagaaggcggttatacaattaatgacaagccaaaccccagaggtgaaatcgta
attggtggacagaacatctccatgggatattttaaaaatgaagagaaaacagcagaagat
tattctgtggatgaaaatggacaaaggtggttttgcactggtgatattggagaattccat
cccgatggatgtttacagattatagatcgtaagaaagatctagtgaagttacaagcagga
gagtatgtatctcttgggaaagtagaagctgcactgaagaattgtccacttattgacaac
atctgtgcttttgccaaaagtgatcagtcctatgtgatcagttttgtggttcctaaccag
aaaaggttgacacttttggcacaacagaaaggggtagaaggaacttgggttgatatctgc
aataatcctgctatggaagctgaaatactgaaagaaattcgagaagctgcaaatgccatg
aaattggagcgatttgaaattccaatcaaggttcgattaagcccagagccatggacccct
gaaactggtttggtaactgatgctttcaaactgaaaaggaaggagctgaggaaccattac
ctcaaagacattgaacgaatgtatgggggcaaataa

DBGET integrated database retrieval system