KEGG   Homo sapiens (human): 2185Help
Entry
2185              CDS       T01001                                 

Gene name
PTK2B, CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04912  GnRH signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
Drug target
Defactinib (DG01827): D10618 D10619
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2185 (PTK2B)
   04072 Phospholipase D signaling pathway
    2185 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2185 (PTK2B)
   04670 Leukocyte transendothelial migration
    2185 (PTK2B)
   04062 Chemokine signaling pathway
    2185 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    2185 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    2185 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2185 (PTK2B)
   05161 Hepatitis B
    2185 (PTK2B)
   05163 Human cytomegalovirus infection
    2185 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2185 (PTK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2185 (PTK2B)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FAK family
   2185 (PTK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Haspin_kinase FERM_F2
Motif
Other DBs
NCBI-GeneID: 2185
NCBI-ProteinID: NP_004094
OMIM: 601212
HGNC: 9612
Ensembl: ENSG00000120899
Vega: OTTHUMG00000102082
Pharos: Q14289(Tchem)
UniProt: Q14289
Structure
PDB: 

Position
8p21.2
AA seq 1009 aa AA seqDB search
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagtcgagtaaagttgggcacgttacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaggacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaaaaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccggttggctgagtgctatgggctgaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccagaagacttc
atggagagcctgaaggaggacaggaccacgctgctctatttttaccaacagctccggaac
gactacatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgccggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccgctggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcatccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggtgagcaccaaggc
tctctcatcatccatcctaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacctctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcccggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaatgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgccgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggagaccggctgcccaagcctgatctctgtccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacgtttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacagccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccgcaaaccaacctcctggctccaaagctgcagttccaggttcct
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccaacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aaggtcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacctggagttcacagggcccccacagaagcccccg
aggctgggcgcacagtccatccagcccacagctaacctggaccggactgatgacctggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctacgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagcgtggatgatctcctgccttccttgccgtcatcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggca
cagcagaacgccgtgacctccctaagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggctgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

DBGET integrated database retrieval system