KEGG   Homo sapiens (human): 219Help
Entry
219               CDS       T01001                                 

Gene name
ALDH1B1, ALDH5, ALDHX
Definition
(RefSeq) aldehyde dehydrogenase 1 family member B1
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00053  Ascorbate and aldarate metabolism
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00330  Arginine and proline metabolism
hsa00340  Histidine metabolism
hsa00380  Tryptophan metabolism
hsa00410  beta-Alanine metabolism
hsa00561  Glycerolipid metabolism
hsa00620  Pyruvate metabolism
hsa01100  Metabolic pathways
Module
hsa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Drug target
Cyanamide: D00123
Disulfiram: D00131
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    219 (ALDH1B1)
   00053 Ascorbate and aldarate metabolism
    219 (ALDH1B1)
   00620 Pyruvate metabolism
    219 (ALDH1B1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    219 (ALDH1B1)
   00561 Glycerolipid metabolism
    219 (ALDH1B1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    219 (ALDH1B1)
   00310 Lysine degradation
    219 (ALDH1B1)
   00330 Arginine and proline metabolism
    219 (ALDH1B1)
   00340 Histidine metabolism
    219 (ALDH1B1)
   00380 Tryptophan metabolism
    219 (ALDH1B1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    219 (ALDH1B1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     219 (ALDH1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 219
NCBI-ProteinID: NP_000683
OMIM: 100670
HGNC: 407
Ensembl: ENSG00000137124
Vega: OTTHUMG00000019938
Pharos: P30837(Tbio)
UniProt: P30837 A0A384MTJ7
Position
9p13.1
AA seq 517 aa AA seqDB search
MLRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPT
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITG
YGPTAGAAIAQHVDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
EHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPFELDTQQGP
QVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRIAKEEIFGP
VQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcttcctggcaccccggctgcttagcctccagggcaggaccgcccgctactcc
tcggcagcagccctcccaagccccattctgaacccagacatcccctacaaccagctgttc
atcaacaatgaatggcaagatgcagtcagcaagaagaccttcccgacggtcaaccctacc
accggggaggtcattgggcacgtggctgaaggtgaccgggctgatgtggatcgggccgtg
aaagcagcccgggaagccttccgcctggggtccccatggcgccggatggatgcctctgag
cggggccggctgctgaaccgcctggcagacctagtggagcgggatcgagtctacttggcc
tcactcgagaccttggacaatgggaagcctttccaagagtcttacgccttggacttggat
gaggtcatcaaggtgtatcggtactttgctggctgggctgacaagtggcatggcaagacc
atccccatggatggccagcatttctgcttcacccggcatgagcccgttggtgtctgtggc
cagatcatcccgtggaacttccccttggtcatgcagggttggaaacttgccccggcactc
gccacaggcaacactgtggttatgaaggtggcagagcagacccccctctctgccctgtat
ttggcctccctcatcaaggaggcaggctttccccctggggtggtgaacatcatcacgggg
tatggcccaacagcaggtgcggccatcgcccagcacgtggatgttgacaaagttgccttc
accggttccaccgaggtgggccacctgatccagaaagcagctggcgattccaacctcaag
agagtcaccctggagctgggtggtaagagccccagcatcgtgctggccgatgctgacatg
gagcatgccgtggagcagtgccacgaagccctgttcttcaacatgggccagtgctgctgt
gctggctcccggaccttcgtggaagaatccatctacaatgagtttctcgagagaaccgtg
gagaaagcaaagcagaggaaagtggggaacccctttgagctggacacccagcaggggcct
caggtggacaaggagcagtttgaacgagtcctaggctacatccagcttggccagaaggag
ggcgcaaaactcctctgtggcggagagcgtttcggggagcgtggtttcttcatcaagcct
actgtctttggtggcgtgcaggatgacatgagaattgccaaagaggagatctttgggcct
gtgcagcccctgttcaagttcaagaagattgaggaggtggttgagagggccaacaacacc
aggtatggcctggctgcggctgtgttcacccgggatctggacaaggccatgtacttcacc
caggcactccaggccgggaccgtgtgggtaaacacctacaacatcgtcacctgccacacg
ccatttggagggtttaaggaatctggaaacgggagggagctgggtgaggatgggcttaag
gcctacacagaggtaaagacggtcaccatcaaggttcctcagaagaactcgtaa

DBGET integrated database retrieval system