KEGG   Homo sapiens (human): 2191Help
Entry
2191              CDS       T01001                                 

Gene name
FAP, DPPIV, FAPA, FAPalpha, SIMP
Definition
(RefSeq) fibroblast activation protein alpha
  KO
K08674  fibroblast activation protein, alpha [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2191 (FAP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     2191 (FAP)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   2191 (FAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPPIV_N Peptidase_S9 DPPIV_rep LIP DLH Abhydrolase_6 Esterase_phd Peptidase_S15 AXE1 PAF-AH_p_II DUF2920
Motif
Other DBs
NCBI-GeneID: 2191
NCBI-ProteinID: NP_004451
OMIM: 600403
HGNC: 3590
Ensembl: ENSG00000078098
Vega: OTTHUMG00000153890
Pharos: Q12884(Tchem)
UniProt: Q12884
Structure
PDB: 

Position
2q24.2
AA seq 760 aa AA seqDB search
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttgggtaaaaatcgtatttggagttgccacctctgctgtgcttgccttattg
gtgatgtgcattgtcttacgcccttcaagagttcataactctgaagaaaatacaatgaga
gcactcacactgaaggatattttaaatggaacattttcttataaaacattttttccaaac
tggatttcaggacaagaatatcttcatcaatctgcagataacaatatagtactttataat
attgaaacaggacaatcatataccattttgagtaatagaaccatgaaaagtgtgaatgct
tcaaattacggcttatcacctgatcggcaatttgtatatctagaaagtgattattcaaag
ctttggagatactcttacacagcaacatattacatctatgaccttagcaatggagaattt
gtaagaggaaatgagcttcctcgtccaattcagtatttatgctggtcgcctgttgggagt
aaattagcatatgtctatcaaaacaatatctatttgaaacaaagaccaggagatccacct
tttcaaataacatttaatggaagagaaaataaaatatttaatggaatcccagactgggtt
tatgaagaggaaatgcttgctacaaaatatgctctctggtggtctcctaatggaaaattt
ttggcatatgcggaatttaatgatacggatataccagttattgcctattcctattatggc
gatgaacaatatcctagaacaataaatattccatacccaaaggctggagctaagaatccc
gttgttcggatatttattatcgataccacttaccctgcgtatgtaggtccccaggaagtg
cctgttccagcaatgatagcctcaagtgattattatttcagttggctcacgtgggttact
gatgaacgagtatgtttgcagtggctaaaaagagtccagaatgtttcggtcctgtctata
tgtgacttcagggaagactggcagacatgggattgtccaaagacccaggagcatatagaa
gaaagcagaactggatgggctggtggattctttgtttcaacaccagttttcagctatgat
gccatttcgtactacaaaatatttagtgacaaggatggctacaaacatattcactatatc
aaagacactgtggaaaatgctattcaaattacaagtggcaagtgggaggccataaatata
ttcagagtaacacaggattcactgttttattctagcaatgaatttgaagaataccctgga
agaagaaacatctacagaattagcattggaagctatcctccaagcaagaagtgtgttact
tgccatctaaggaaagaaaggtgccaatattacacagcaagtttcagcgactacgccaag
tactatgcacttgtctgctacggcccaggcatccccatttccacccttcatgatggacgc
actgatcaagaaattaaaatcctggaagaaaacaaggaattggaaaatgctttgaaaaat
atccagctgcctaaagaggaaattaagaaacttgaagtagatgaaattactttatggtac
aagatgattcttcctcctcaatttgacagatcaaagaagtatcccttgctaattcaagtg
tatggtggtccctgcagtcagagtgtaaggtctgtatttgctgttaattggatatcttat
cttgcaagtaaggaagggatggtcattgccttggtggatggtcgaggaacagctttccaa
ggtgacaaactcctctatgcagtgtatcgaaagctgggtgtttatgaagttgaagaccag
attacagctgtcagaaaattcatagaaatgggtttcattgatgaaaaaagaatagccata
tggggctggtcctatggaggatacgtttcatcactggcccttgcatctggaactggtctt
ttcaaatgtggtatagcagtggctccagtctccagctgggaatattacgcgtctgtctac
acagagagattcatgggtctcccaacaaaggatgataatcttgagcactataagaattca
actgtgatggcaagagcagaatatttcagaaatgtagactatcttctcatccacggaaca
gcagatgataatgtgcactttcaaaactcagcacagattgctaaagctctggttaatgca
caagtggatttccaggcaatgtggtactctgaccagaaccacggcttatccggcctgtcc
acgaaccacttatacacccacatgacccacttcctaaagcagtgtttctctttgtcagac
taa

DBGET integrated database retrieval system