KEGG   Homo sapiens (human): 2194Help
Entry
2194              CDS       T01001                                 

Gene name
FASN, FAS, OA-519, SDR27X1
Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa04152  AMPK signaling pathway
hsa04910  Insulin signaling pathway
Module
hsa_M00082  Fatty acid biosynthesis, initiation
hsa_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    2194 (FASN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    2194 (FASN)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2194 (FASN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    2194 (FASN)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2194 (FASN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase
     2194 (FASN)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Animal type
   2194 (FASN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2194 (FASN)
  Exosomal proteins of breast milk
   2194 (FASN)
  Exosomal proteins of colorectal cancer cells
   2194 (FASN)
  Exosomal proteins of bladder cancer cells
   2194 (FASN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt Thioesterase KR Ketoacyl-synt_C KAsynt_C_assoc PS-DH ADH_zinc_N ADH_zinc_N_2 PP-binding Methyltransf_12 Methyltransf_31 adh_short Thiolase_N Methyltransf_11 Methyltransf_25 Methyltransf_23 YjeF_N adh_short_C2 ACP_syn_III PE-PPE L27
Motif
Other DBs
NCBI-GeneID: 2194
NCBI-ProteinID: NP_004095
OMIM: 600212
HGNC: 3594
Ensembl: ENSG00000169710
Vega: OTTHUMG00000178527
Pharos: P49327(Tchem)
UniProt: P49327
Structure
PDB: 

Position
17q25.3
AA seq 2511 aa AA seqDB search
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL
PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP
EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE
FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ
WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL
LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV
SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL
CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL
SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA
ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL
FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG
AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG
VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE
PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI
RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL
ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA
MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV
EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD
SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS
PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA
DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
NT seq 7536 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggtgattgccggcatgtccgggaagctgccagagtcggagaacttgcag
gagttctgggacaacctcatcggcggtgtggacatggtcacggacgatgaccgtcgctgg
aaggcggggctctacggcctgccccggcggtccggcaagctgaaggacctgtctaggttt
gatgcctccttcttcggagtccaccccaagcaggcacacacgatggaccctcagctgcgg
ctgctgctggaagtcacctatgaagccatcgtggacggaggcatcaacccagattcactc
cgaggaacacacactggcgtctgggtgggcgtgagcggctctgagacctcggaggccctg
agccgagaccccgagacactcgtgggctacagcatggtgggctgccagcgagcgatgatg
gccaaccggctctccttcttcttcgacttcagagggcccagcatcgcactggacacagcc
tgctcctccagcctgatggccctgcagaacgcctaccaggccatccacagcgggcagtgc
cctgccgccatcgtggggggcatcaatgtcctgctgaagcccaacacctccgtgcagttc
ttgaggctggggatgctcagccccgagggcacctgcaaggccttcgacacagcggggaat
gggtactgccgctcggagggtgtggtggccgtcctgctgaccaagaagtccctggcccgg
cgggtgtacgccaccatcctgaacgccggcaccaatacagatggcttcaaggagcaaggc
gtgaccttcccctcaggggatatccaggagcagctcatccgctcgttgtaccagtcggcc
ggagtggcccctgagtcatttgaatacatcgaagcccacggcacaggcaccaaggtgggc
gacccccaggagctgaatggcatcacccgagccctgtgcgccacccgccaggagccgctg
ctcatcggctccaccaagtccaacatggggcacccggagccagcctcggggctggcagcc
ctggccaaggtgctgctgtccctggagcacgggctctgggcccccaacctgcacttccat
agccccaaccctgagatcccagcgctgttggatgggcggctgcaggtggtggaccagccc
ctgcccgtccgtggcggcaacgtgggcatcaactcctttggcttcgggggctccaacgtg
cacatcatcctgaggcccaacacgcagccgccccccgcacccgccccacatgccaccctg
ccccgtctgctgcgggccagcggacgcacccctgaggccgtgcagaagctgctggagcag
ggcctccggcacagccaggacctggctttcctgagcatgctgaacgacatcgcggctgtc
cccgccaccgccatgcccttccgtggctacgctgtgctgggtggtgagcgcggtggccca
gaggtgcagcaggtgcccgctggcgagcgcccgctctggttcatctgctctgggatgggc
acacagtggcgcgggatggggctgagcctcatgcgcctggaccgcttccgagattccatc
ctacgctccgatgaggctgtgaagccattcggcctgaaggtgtcacagctgctgctgagc
acagacgagagcacctttgatgacatcgtccattcgtttgtgagcctgactgccatccag
ataggcctcatagacctgctgagctgcatggggctgaggccagatggcatcgtcggccac
tccctgggggaggtggcctgtggctacgccgacggctgcctgtcccaggaggaggccgtc
ctcgctgcctactggaggggacagtgcatcaaagaagcccatctcccgccgggcgccatg
gcagccgtgggcttgtcctgggaggagtgtaaacagcgctgccccccgggcgtggtgccc
gcctgccacaactccaaggacacagtcaccatctcgggacctcaggccccggtgtttgag
ttcgtggagcagctgaggaaggagggtgtgtttgccaaggaggtgcggaccggcggtatg
gccttccactcctacttcatggaggccatcgcacccccactgctgcaggagctcaagaag
gtgatccgggagccgaagccacgttcagcccgctggctcagcacctctatccccgaggcc
cagtggcacagcagcctggcacgcacgtcctccgccgagtacaatgtcaacaacctggtg
agccctgtgctgttccaggaggccctgtggcacgtgcctgagcacgcggtggtgctggag
atcgcgccccacgccctgctgcaggctgtcctgaagcgtggcctgaagccgagctgcacc
atcatccccctgatgaagaaggatcacagggacaacctggagttcttcctggccggcatc
ggcaggctgcacctctcaggcatcgacgccaaccccaatgccttgttcccacctgtggag
ttcccagctccccgaggaactcccctcatctccccactcatcaagtgggaccacagcctg
gcctgggacgtgccggccgccgaggacttccccaacggttcaggttccccctcagccgcc
atctacaacatcgacaccagctccgagtctcctgaccactacctggtggaccacaccctc
gacggtcgcgtcctcttccccgccactggctacctgagcatagtgtggaagacgctggcc
cgcgccctgggcctgggcgtcgagcagctgcctgtggtgtttgaggatgtggtgctgcac
caggccaccatcctgcccaagactgggacagtgtccctggaggtacggctcctggaggcc
tcccgtgccttcgaggtgtcagagaacggcaacctggtagtgagtgggaaggtgtaccag
tgggatgaccctgaccccaggctcttcgaccacccggaaagccccacccccaaccccacg
gagcccctcttcctggcccaggctgaagtttacaaggagctgcgtctgcgtggctacgac
tacggccctcatttccagggcatcctggaggccagcctggaaggtgactcggggaggctg
ctgtggaaggataactgggtgagcttcatggacaccatgctgcagatgtccatcctgggc
tcggccaagcacggcctgtacctgcccacccgtgtcaccgccatccacatcgaccctgcc
acccacaggcagaagctgtacacactgcaggacaaggcccaagtggctgacgtggtggtg
agcaggtggctgagggtcacagtggccggaggcgtccacatctccgggctccacactgag
tcggccccgcggcggcagcaggagcagcaggtgcccatcctggagaagttttgcttcact
ccccacacggaggaggggtgcctgtctgagcgcgctgccctgcaggaggagctgcaactg
tgcaaggggctggtgcaggcactgcagaccaaggtgacccagcaggggctgaagatggtg
gtgcccggactggatggggcccagatcccccgggacccctcacagcaggaactgccccgg
ctgttgtcggctgcctgcaggcttcagctcaacgggaacctgcagctggagctggcgcag
gtgctggcccaggagaggcccaagctgccagaggaccctctgctcagcggcctcctggac
tccccggcactcaaggcctgcctggacactgccgtggagaacatgcccagcctgaagatg
aaggtggtggaggtgctggctggccacggtcacctgtattcccgcatcccaggcctgctc
agcccccatcccctgctgcagctgagctacacggccaccgaccgccacccccaggccctg
gaggctgcccaggccgagctgcagcagcacgacgttgcccagggccagtgggatcccgca
gaccctgcccccagcgccctgggcagcgccgacctcctggtgtgcaactgtgctgtggct
gccctcggggacccggcctcagctctcagcaacatggtggctgccctgagagaagggggc
tttctgctcctgcacacactgctccgggggcaccccctcggggacatcgtggccttcctc
acctccactgagccgcagtatggccagggcatcctgagccaggacgcgtgggagagcctc
ttctccagggtgtcgctgcgcctggtgggcctgaagaagtccttctacggctccacgctc
ttcctgtgccgccggcccaccccgcaggacagccccatcttcctgccggtggacgatacc
agcttccgctgggtggagtctctgaagggcatcctggctgacgaagactcttcccggcct
gtgtggctgaaggccatcaactgtgccacctcgggcgtggtgggcttggtgaactgtctc
cgccgagagcccggcgggaaccgcctccggtgtgtgctgctctccaacctcagcagcacc
tcccacgtcccggaggtggacccgggctccgcagaactgcagaaggtgttgcagggagac
ctggtgatgaacgtctaccgcgacggggcctggggggctttccgccacttcctgctggag
gaggacaagcctgaggagccgacggcacatgcctttgtgagcaccctcacccggggggac
ctgtcctccatccgctgggtctgctcctcgctgcgccatgcccagcccacctgccctggc
gcccagctctgcacggtctactacgcctccctcaacttccgcgacatcatgctggccact
ggcaagctgtcccctgatgccatcccagggaagtggacctcccaggacagcctgctaggt
atggagttctcgggccgagacgccagcggcaagcgtgtgatgggactggtgcctgccaag
ggcctggccacctctgtcctgctgtcaccggacttcctctgggatgtgccttccaactgg
acgctggaggaggcggcctcggtgcctgtcgtctacagcacggcctactacgcgctggtg
gtgcgtgggcgggtgcgccccggggagacgctgctcatccactcgggctcgggcggcgtg
ggccaggccgccatcgccatcgccctcagtctgggctgccgcgtcttcaccaccgtgggg
tcggctgagaagcgggcgtacctccaggccaggttcccccagctcgacagcaccagcttc
gccaactcccgggacacatccttcgagcagcatgtgctgtggcacacgggcgggaagggc
gttgacctggtcttgaactccttggcggaagagaagctgcaggccagcgtgaggtgcttg
gctacgcacggtcgcttcctggaaattggcaaattcgacctttctcagaaccacccgctc
ggcatggctatcttcctgaagaacgtgacattccacggggtcctactggatgcgttcttc
aacgagagcagtgctgactggcgggaggtgtgggcgcttgtgcaggccggcatccgggat
ggggtggtacggcccctcaagtgcacggtgttccatggggcccaggtggaggacgccttc
cgctacatggcccaagggaagcacattggcaaagtcgtcgtgcaggtgcttgcggaggag
ccggaggcagtgctgaagggggccaaacccaagctgatgtcggccatctccaagaccttc
tgcccggcccacaagagctacatcatcgctggtggtctgggtggcttcggcctggagttg
gcgcagtggctgatacagcgtggggtgcagaagctcgtgttgacttctcgctccgggatc
cggacaggctaccaggccaagcaggtccgccggtggaggcgccagggcgtacaggtgcag
gtgtccaccagcaacatcagctcactggagggggcccggggcctcattgccgaggcggcg
cagcttgggcccgtgggcggcgtcttcaacctggccgtggtcttgagagatggcttgctg
gagaaccagaccccagagttcttccaggacgtctgcaagcccaagtacagcggcaccctg
aacctggacagggtgacccgagaggcgtgccctgagctggactactttgtggtcttctcc
tctgtgagctgcgggcgtggcaatgcgggacagagcaactacggctttgccaattccgcc
atggagcgtatctgtgagaaacgccggcacgaaggcctcccaggcctggccgtgcagtgg
ggcgccatcggcgacgtgggcattttggtggagacgatgagcaccaacgacacgatcgtc
agtggcacgctgccccagcgcatggcgtcctgcctggaggtgctggacctcttcctgaac
cagccccacatggtcctgagcagctttgtgctggctgagaaggctgcggcctatagggac
agggacagccagcgggacctggtggaggccgtggcacacatcctgggcatccgcgacttg
gctgctgtcaacctggacagctcactggcggacctgggcctggactcgctcatgagcgtg
gaggtgcgccagacgctggagcgtgagctcaacctggtgctgtccgtgcgcgaggtgcgg
caactcacgctccggaaactgcaggagctgtcctcaaaggcggatgaggccagcgagctg
gcatgccccacgcccaaggaggatggtctggcccagcagcagactcagctgaacctgcgc
tccctgctggtgaacccggagggccccaccctgatgcggctcaactccgtgcagagctcg
gagcggcccctgttcctggtgcacccaatcgagggctccaccaccgtgttccacagcctg
gcctcccggctcagcatccccacctatggcctgcagtgcacccgagctgcgccccttgac
agcatccacagcctggctgcctactacatcgactgcatcaggcaggtgcagcccgagggc
ccctaccgcgtggccggctactcctacggggcctgcgtggcctttgaaatgtgctcccag
ctgcaggcccagcagagcccagcccccacccacaacagcctcttcctgttcgacggctcg
cccacctacgtactggcctacacccagagctaccgggcaaagctgaccccaggctgtgag
gctgaggctgagacggaggccatatgcttcttcgtgcagcagttcacggacatggagcac
aacagggtgctggaggcgctgctgccgctgaagggcctagaggagcgtgtggcagccgcc
gtggacctgatcatcaagagccaccagggcctggaccgccaggagctgagctttgcggcc
cggtccttctactacaagctgcgtgccgctgagcagtacacacccaaggccaagtaccat
ggcaacgtgatgctactgcgcgccaagacgggtggcgcctacggcgaggacctgggcgcg
gactacaacctctcccaggtatgcgacgggaaagtatccgtccacgtcatcgagggtgac
caccgcacgctgctggagggcagcggcctggagtccatcatcagcatcatccacagctcc
ctggctgagccacgcgtgagcgtgcgggagggctag

DBGET integrated database retrieval system