KEGG   Homo sapiens (human): 219429Help
Entry
219429            CDS       T01001                                 

Gene name
OR4C11, OR11-136, OR4C11P
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 11
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219429 (OR4C11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219429 (OR4C11)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219429 (OR4C11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 219429
NCBI-ProteinID: NP_001004700
HGNC: 15167
Ensembl: ENSG00000172188
Vega: OTTHUMG00000165290
Pharos: Q6IEV9(Tdark)
UniProt: Q6IEV9 A0A126GVN6
Position
11q11
AA seq 310 aa AA seqDB search
MQQNNSVPEFILLGLTQDPLRQKIVFVIFLIFYMGTVVGNMLIIVTIKSSRTLGSPMYFF
LFYLSFADSCFSTSTAPRLIVDALSEKKIITYNECMTQVFALHLFGCMEIFVLILMAVDR
YVAICKPLRYPTIMSQQVCIILIVLAWIGSLIHSTAQIILALRLPFCGPYLIDHYCCDLQ
PLLKLACMDTYMINLLLVSNSGAICSSSFMILIISYIVILHSLRNHSAKGKKKALSACTS
HIIVVILFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMRKLW
HGKIISENKG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaataacagtgtgcctgaattcatactgttaggattaacacaggatcccttg
aggcagaaaatagtgtttgtaatcttcttaattttctatatgggaactgtggtggggaat
atgctcattattgtgaccatcaagtccagccggacactaggaagccccatgtacttcttt
ctattttatttgtcctttgcagattcttgcttttcaacttccacagcccctagattaatt
gtggatgctctctctgaaaagaaaattataacctacaatgagtgcatgacacaagtcttt
gcactacatttatttggctgcatggagatctttgtcctcattctcatggctgttgatcgc
tatgtggccatctgtaagcccttgcgttacccaaccatcatgagccagcaggtctgcatc
atcctgattgttcttgcctggatagggtctttaatacactctacagctcagattatcctg
gccttaagattgcctttctgtggaccctatttgattgatcattattgctgtgatttgcag
cccttgttgaaacttgcctgcatggacacttacatgatcaacctgctgttggtgtctaac
agtggggcaatttgctcaagtagtttcatgattttgataatttcatatattgtcatcttg
cattcactgagaaaccacagtgccaaagggaagaaaaaggctctctccgcttgcacgtct
cacataattgtagtcatcttattctttggcccatgtatattcatatatacacgccccccg
accactttccccatggacaagatggtggcagtattttatactattggaacaccctttctc
aatccactcatctacacactgaggaatgcagaagtgaaaaatgccatgagaaagttatgg
catggcaaaattatttcagaaaacaaaggataa

DBGET integrated database retrieval system