KEGG   Homo sapiens (human): 219431Help
Entry
219431            CDS       T01001                                 

Gene name
OR4S2, OR11-137, OR4S2P, OST725
Definition
(RefSeq) olfactory receptor family 4 subfamily S member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219431 (OR4S2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219431 (OR4S2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219431 (OR4S2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 219431
NCBI-ProteinID: NP_001004059
HGNC: 15183
Ensembl: ENSG00000174982
Vega: OTTHUMG00000166799
Pharos: Q8NH73(Tdark)
UniProt: Q8NH73 A0A126GVG1
Position
11q11
AA seq 311 aa AA seqDB search
MEKINNVTEFIFWGLSQSPEIEKVCFVVFSFFYIIILLGNLLIMLTVCLSNLFKSPMYFF
LSFLSFVDICYSSVTAPKMIVDLLAKDKTISYVGCMLQLFGVHFFGCTEIFILTVMAYDR
YVAICKPLHYMTIMNRETCNKMLLGTWVGGFLHSIIQVALVVQLPFCGPNEIDHYFCDVH
PVLKLACTETYIVGVVVTANSGTIALGSFVILLISYSIILVSLRKQSAEGRRKALSTCGS
HIAMVVIFFGPCTFMYMRPDTTFSEDKMVAVFYTIITPMLNPLIYTLRNAEVKNAMKKLW
GRNVFLEAKGK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaataaacaacgtaactgaattcattttctggggtctttctcagagcccagag
attgagaaagtttgttttgtggtgttttctttcttctacataatcattcttctgggaaat
ctcctcatcatgctgacagtttgcctgagcaacctgtttaagtcacccatgtatttcttt
ctcagcttcttgtcttttgtggacatttgttactcttcagtcacagctcccaagatgatt
gttgacctgttagcaaaggacaaaaccatctcctatgtggggtgcatgttgcaactgttt
ggagtacatttctttggttgcactgagatcttcatccttactgtaatggcctatgatcgt
tatgtggctatctgtaaacccctacattatatgaccatcatgaaccgggagacatgcaat
aaaatgttattagggacgtgggtaggtgggttcttacactccattatccaagtggctctg
gtagtccaactacccttttgtggacccaatgagatagatcactacttttgtgatgttcac
cctgtgttgaaacttgcctgcacagaaacatacattgttggtgttgttgtgacagccaac
agtggtaccattgctctggggagttttgttatcttgctaatctcctacagcatcatccta
gtttccctgagaaagcagtcagcagaaggcaggcgcaaagccctctccacctgtggctcc
cacattgccatggtcgttatctttttcggcccctgtacttttatgtacatgcgccctgat
acgaccttttcagaggataagatggtggctgtattttacaccattatcactcccatgtta
aatcctctgatttatacactgagaaatgcagaagtaaagaatgcaatgaagaaactgtgg
ggcagaaatgttttcttggaggctaaagggaaatag

DBGET integrated database retrieval system