KEGG   Homo sapiens (human): 219437Help
Entry
219437            CDS       T01001                                 

Gene name
OR5L1, OR11-151, OST262
Definition
(RefSeq) olfactory receptor family 5 subfamily L member 1 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219437 (OR5L1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219437 (OR5L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219437
NCBI-ProteinID: NP_001004738
HGNC: 8350
Ensembl: ENSG00000279395
Vega: OTTHUMG00000166810
Pharos: Q8NGL2(Tdark)
UniProt: Q8NGL2 A0A126GVL0
Position
11q12.1
AA seq 311 aa AA seqDB search
MGKENCTTVAEFILLGLSDVPELRVCLFLLFLLIYGVTLLANLGMIALIQVSSRLHTPMY
FFLSHLSSVDFCYSSIIVPKMLANIFNKDKAISFLGCMVQFYLFCTCVVTEVFLLAVMAY
DRFVAICNPLLYTVTMSWKVRVELASCCYFCGTVCSLIHLCLALRIPFYRSNVINHFFCD
LPPVLSLACSDITVNETLLFLVATLNESVTIMIILTSYLLILTTILKMGSAEGRHKAFST
CASHLTAITVFHGTVLSIYCRPSSGNSGDADKVATVFYTVVIPMLNSVIYSLRNKDVKEA
LRKVMGSKIHS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaactgcaccactgtggctgagttcattctccttggactatcagatgtc
cctgagttgagagtctgcctcttcctgctgttccttctcatctatggagtcacgttgtta
gccaacctgggcatgattgcactgattcaggtcagctctcggctccacacccccatgtac
tttttcctcagccacttgtcctctgtagatttctgctactcctcaataattgtgccaaaa
atgttggctaatatctttaacaaggacaaagccatctccttcctagggtgcatggtgcaa
ttctacttgttttgcacttgtgtggtcactgaggtcttcctgctggccgtgatggcctat
gaccgctttgtggccatctgtaaccctttgctatacacagtcaccatgtcttggaaggtg
cgtgtggagctggcttcttgctgctacttctgtgggacggtgtgttctctgattcatttg
tgcttagctcttaggatccccttctatagatctaatgtgattaaccactttttctgtgat
ctacctcctgtcttaagtcttgcttgctctgatatcactgtgaatgagacactgctgttc
ctggtggccactttgaatgagagtgttaccatcatgatcatcctcacctcctacctgcta
attctcaccaccatcctgaagatgggctctgcagagggcaggcacaaagccttctccacc
tgtgcttcccacctcacagctatcactgtcttccatggaacagtcctttccatttattgc
aggcccagttcaggcaatagtggagatgctgacaaagtggccaccgtgttctacacagtc
gtgattcctatgctgaactctgtgatctacagcctgagaaataaagatgtgaaagaagct
ctcagaaaagtgatgggctccaaaattcactcctag

DBGET integrated database retrieval system