KEGG   Homo sapiens (human): 219464Help
Entry
219464            CDS       T01001                                 

Gene name
OR5T2, OR11-177
Definition
(RefSeq) olfactory receptor family 5 subfamily T member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219464 (OR5T2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219464 (OR5T2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219464
NCBI-ProteinID: NP_001004746
HGNC: 15296
Ensembl: ENSG00000181718
Vega: OTTHUMG00000166851
Pharos: Q8NGG2(Tdark)
UniProt: Q8NGG2
Position
11q12.1
AA seq 359 aa AA seqDB search
MSYSIYKSTVNIPLSHGVVHSFCHNMNCNFMHIFKFVLDFNMKNVTEVTLFVLKGFTDNL
ELQTIFFFLFLAIYLFTLMGNLGLILVVIRDSQLHKPMYYFLSMLSSVDACYSSVITPNM
LVDFTTKNKVISFLGCVAQVFLACSFGTTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVY
MPLINASYVAGILHATIHTVATFSLSFCGANEIRRVFCDIPPLLAISYSDTHTNQLLLFY
FVGSIELVTILIVLISYGLILLAILKMYSAEGRRKVFSTCGAHLTGVSIYYGTILFMYVR
PSSSYASDHDMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacagtatatacaagagcacagttaacatccccttgagtcatggtgttgttcat
tctttttgtcataatatgaactgtaactttatgcatatcttcaagtttgttctagatttc
aacatgaagaatgtcactgaagttaccttatttgtactgaagggcttcacagacaatctt
gaactgcagactatcttcttcttcctgtttctagcaatctacctcttcactctcatggga
aatttaggactgattttagtggtcattagggattcccagctccacaaacccatgtactat
tttctgagtatgttgtcttctgtggatgcctgctattcctcagttattaccccaaatatg
ttagtagattttacgacaaagaataaagtcatttcattccttggatgtgtagcacaggtg
tttcttgcttgtagttttggaaccacagaatgctttctcttggctgcaatggcttatgat
cgctatgtagccatctacaaccctctcctgtattcagtgagcatgtcacccagagtctac
atgccactcatcaatgcttcctatgttgctggcattttacatgctactatacatacagtg
gctacatttagcctatccttctgtggagccaatgaaattaggcgtgtcttttgtgatatc
cctcctctccttgctatttcttattctgacactcacacaaaccagcttctactcttctac
tttgtgggctctatcgagctggtcactatcctgattgttctgatctcctatggtttgatt
ctgttggccattctgaagatgtattctgctgaagggaggagaaaagtcttctccacatgt
ggagctcacctaactggagtgtcaatttattatgggacaatcctcttcatgtatgtgaga
ccaagttccagctatgcttcggaccatgacatgatagtgtcaatattttacaccattgtg
attcccttgctgaatcccgtcatctacagtttgaggaacaaagatgtaaaagactcaatg
aaaaaaatgtttgggaaaaatcaggttatcaataaagtatattttcatactaaaaaataa

DBGET integrated database retrieval system