KEGG   Homo sapiens (human): 219473Help
Entry
219473            CDS       T01001                                 

Gene name
OR8K3, OR11-181
Definition
(RefSeq) olfactory receptor family 8 subfamily K member 3 (gene/pseudogene)
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219473 (OR8K3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219473 (OR8K3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219473 (OR8K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219473
NCBI-ProteinID: NP_001005202
HGNC: 15313
Ensembl: ENSG00000280314
Vega: OTTHUMG00000166855
Pharos: Q8NH51(Tdark)
UniProt: Q8NH51
Position
11q12.1
AA seq 312 aa AA seqDB search
MEQHNLTTVNEFILTGITDIAELQAPLFALFLMIYVISVMGNLGMIVLTKLDSRLQTPMY
FFLRHLAFMDLGYSTTVGPKMLVNFVVDKNIISYYFCATQLAFFLVFIGSELFILSAMSY
DLYVAICNPLLYTVIMSRRVCQVLVAIPYLYCTFISLLVTIKIFTLSFCGYNVISHFYCD
SLPLLPLLCSNTHEIELIILIFAAIDLISSLLIVLLSYLLILVAILRMNSAGRQKAFSTC
GAHLTVVIVFYGTLLFMYVQPKSSHSFDTDKVASIFYTLVIPMLNPLIYSLRNKDVKYAL
RRTWNNLCNIFV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaacaacacaatctaacaacggtgaatgaattcattcttacgggaatcacagatatc
gctgagctgcaggcaccattatttgcattgttcctcatgatctatgtgatctcagtgatg
ggcaatttgggcatgattgtcctcaccaagttggactccaggttgcaaacccctatgtac
ttttttctcagacatctggctttcatggatcttggttattcaacaactgtgggacccaaa
atgttagtaaattttgttgtggataagaatataatttcttattatttttgtgcaacacag
ctagctttctttcttgtgttcattggtagtgaactttttattctctcagccatgtcctac
gacctctatgtggccatctgtaaccctctgctatacacagtaatcatgtcacgaagggta
tgtcaggtgctggtagcaatcccttacctctattgcacattcatttctcttctagtcacc
ataaagatttttactttatccttctgtggctacaacgtcattagtcatttctactgtgac
agtctccctttgttacctttgctttgttcaaatacacatgaaattgaattgataattctg
atctttgcagctattgatttgatttcatctcttctgatagttcttttatcttacctgctc
atccttgtagccattctcaggatgaattctgctggcagacaaaaggctttttctacctgt
ggagcccacctgacagtggtcatagtgttctatgggactttgcttttcatgtacgtgcag
cccaagtccagtcattcctttgacactgataaagtggcttccatattttacaccctggtt
atccccatgttgaatcccttgatctatagtttacgaaacaaagatgtaaaatatgcccta
cgaaggacatggaataacttatgtaatatttttgtttaa

DBGET integrated database retrieval system