KEGG   Homo sapiens (human): 219477Help
Entry
219477            CDS       T01001                                 

Gene name
OR8J1, OR11-183
Definition
(RefSeq) olfactory receptor family 8 subfamily J member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219477 (OR8J1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219477 (OR8J1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 219477
NCBI-ProteinID: NP_001005205
HGNC: 14855
Ensembl: ENSG00000172487
Vega: OTTHUMG00000166859
Pharos: Q8NGP2(Tdark)
UniProt: Q8NGP2
Position
11q12.1
AA seq 316 aa AA seqDB search
MAPENFTRVTEFILTGVSSCPELQIPLFLVFLVLYGLTMAGNLGIITLTSVDSRLQTPMY
FFLQHLALINLGNSTVIAPKMLINFLVKKKTTSFYECATQLGGFLFFIVSEVIMLALMAY
DRYVAICNPLLYMVVVSRRLCLLLVSLTYLYGFSTAIVVSSYVFSVSYCSSNIINHFYCD
NVPLLALSCSDTYLPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFST
CASHMMAVTIFYGTLLFMYVQPRSNHSLDTDDKMASVFYTLVIPMLNPLIYSLRNKDVKT
ALQRFMTNLCYSFKTM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgaaaatttcaccagagtcactgagtttattcttacaggtgtctctagctgt
ccagagctccagattcccctcttcctggtctttctggtgctctatgggctgaccatggca
gggaacctgggcatcatcaccctcaccagtgttgactctcgacttcaaacccccatgtac
tttttcctgcaacatctggctctcattaatcttggtaactctactgtcattgcccctaaa
atgctgattaactttttagtaaagaagaaaactacctcattctatgaatgtgccacccaa
ctgggagggttcttgttctttattgtatcggaggtaatcatgctggctttgatggcctat
gaccgctatgtggctatttgtaaccctctgctgtacatggtggtggtgtctcggcggctc
tgcctcctgctggtctccctcacatacctctatggcttttctacagctattgtggtttca
tcttatgtattctctgtgtcttattgctcttctaatataatcaatcatttttactgtgat
aatgttcctctgttagcattatcttgctctgatacttacttaccagaaacagttgtcttt
atatctgcagcaacaaatgtggttggttccttgattatagttctagtatcttatttcaat
attgttttgtctattttaaaaatatgttcatcagaaggaaggaaaaaagccttttctacc
tgtgcttcacatatgatggcagtcacaattttttatgggacattgctattcatgtatgtg
cagccccgaagtaaccattcactggatactgatgataagatggcttctgtgttttacacg
ttggtaattcctatgctgaatcccttgatctacagcctgaggaataaggatgtgaagact
gctctacagagattcatgacaaatctgtgctattcctttaaaacaatgtaa

DBGET integrated database retrieval system