KEGG   Homo sapiens (human): 219484Help
Entry
219484            CDS       T01001                                 

Gene name
OR5M8, OR11-194
Definition
(RefSeq) olfactory receptor family 5 subfamily M member 8
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    219484 (OR5M8)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    219484 (OR5M8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF2842
Motif
Other DBs
NCBI-GeneID: 219484
NCBI-ProteinID: NP_001005282
HGNC: 14846
Ensembl: ENSG00000181371
Vega: OTTHUMG00000166877
Pharos: Q8NGP6(Tdark)
UniProt: Q8NGP6 A0A126GWD6
Position
11q12.1
AA seq 311 aa AA seqDB search
MRRNCTLVTEFILLGLTSRRELQILLFTLFLAIYMVTVAGNLGMIVLIQANAWLHMPMYF
FLSHLSFVDLCFSSNVTPKMLEIFLSEKKSISYPACLVQCYLFIALVHVEIYILAVMAFD
RYMAICNPLLYGSRMSKSVCSFLITVPYVYGALTGLMETMWTYNLAFCGPNEINHFYCAD
PPLIKLACSDTYNKELSMFIVAGWNLSFSLFIICISYLYIFPAILKIRSTEGRQKAFSTC
GSHLTAVTIFYATLFFMYLRPPSKESVEQGKMVAVFYTTVIPMLNLIIYSLRNKNVKEAL
IKELSMKIYFS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaactgcacgttggtgactgagttcattctcctgggactgaccagtcgccgg
gaattacaaattctcctcttcacgctgtttctggccatttacatggtcacggtggcaggg
aaccttggcatgattgtcctcatccaggccaacgcctggctccacatgcccatgtacttt
ttcctgagccacttatccttcgtggatctgtgcttctcttccaatgtgactccaaagatg
ctggagattttcctttcagagaagaaaagcatttcctatcctgcctgtcttgtgcagtgt
tacctttttatcgccttggtccatgttgagatctacatcctggctgtgatggcctttgac
cggtacatggccatctgcaaccctctgctttatggcagcagaatgtccaagagtgtgtgc
tccttcctcatcacggtgccttatgtgtatggagcgctcactggcctgatggagaccatg
tggacctacaacctagccttctgtggccccaatgaaattaatcacttctactgtgcggac
ccaccactgattaagctggcttgttctgacacctacaacaaggagttgtcaatgtttatt
gtggctggctggaacctttctttttctctcttcatcatatgtatttcctacctttacatt
ttccctgctattttaaagattcgctctacagagggcaggcaaaaagctttttctacctgt
ggctcccatctgacagctgtcactatattctatgcaacccttttcttcatgtatctcaga
cccccctcaaaggaatctgttgaacagggtaaaatggtagctgtattttataccacagta
atccctatgctgaaccttataatttatagccttagaaataaaaatgtaaaagaagcatta
atcaaagagctgtcaatgaagatatacttttcttaa

DBGET integrated database retrieval system