KEGG   Homo sapiens (human): 219487Help
Entry
219487            CDS       T01001                                 

Gene name
OR5M11, OR11-199
Definition
(RefSeq) olfactory receptor family 5 subfamily M member 11
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219487 (OR5M11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219487 (OR5M11)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219487 (OR5M11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF5389
Motif
Other DBs
NCBI-GeneID: 219487
NCBI-ProteinID: NP_001005245
HGNC: 15291
Ensembl: ENSG00000255223
Vega: OTTHUMG00000166861
Pharos: Q96RB7(Tdark)
UniProt: Q96RB7 A0A126GVL9
Position
11q12.1
AA seq 305 aa AA seqDB search
MSNTNGSAITEFILLGLTDCPELQSLLFVLFLVVYLVTLLGNLGMIMLMRLDSRLHTPMY
FFLTNLAFVDLCYTSNATPQMSTNIVSEKTISFAGCFTQCYIFIALLLTEFYMLAAMAYD
RYVAIYDPLRYSVKTSRRVCICLATFPYVYGFSDGLFQAILTFRLTFCRSSVINHFYCAD
PPLIKLSCSDTYVKEHAMFISAGFNLSSSLTIVLVSYAFILAAILRIKSAEGRHKAFSTC
GSHMMAVTLFYGTLFCMYIRPPTDKTVEESKIIAVFYTFVSPVLNPLIYSLRNKDVKQAL
KNVLR
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacaaatggcagtgcaatcacagaattcattttacttgggctcacagattgc
ccggaactccagtctctgctttttgtgctgtttctggttgtttacctcgtcaccctgcta
ggcaacctgggcatgataatgttaatgagactggactctcgccttcacacgcccatgtac
ttcttcctcactaacttagcctttgtggatttgtgctatacatcaaatgcaaccccgcag
atgtcgactaatatcgtatctgagaagaccatttcctttgctggttgctttacacagtgc
tacattttcattgcccttctactcactgagttttacatgctggcagcaatggcctatgac
cgctatgtggccatatatgaccctctgcgctacagtgtgaaaacgtccaggagagtttgc
atctgcttggccacatttccctatgtctatggcttctcagatggactcttccaggccatc
ctgaccttccgcctgaccttctgtagatccagtgtcatcaaccacttctactgtgctgac
ccgccgctcattaagctttcttgttctgatacttatgtcaaagagcatgccatgttcata
tctgctggcttcaacctctccagctccctcaccatcgtcttggtgtcctatgccttcatt
cttgctgccatcctccggatcaaatcagcagagggaaggcacaaggcattctccacctgt
ggttcccatatgatggctgtcaccctgttttatgggactctcttttgcatgtatataaga
ccaccaacagataagactgttgaggaatctaaaataatagctgtcttttacacctttgtg
agtccggtacttaatccattgatctacagtctgaggaataaagatgtgaagcaggccttg
aagaatgtcctgagatga

DBGET integrated database retrieval system