KEGG   Homo sapiens (human): 2196
Entry
2196              CDS       T01001                                 
Symbol
FAT2, CDHF8, CDHR9, HFAT2, MEGF1, SCA45
Name
(RefSeq) FAT atypical cadherin 2
  KO
K16506  protocadherin Fat 1/2/3
Organism
hsa  Homo sapiens (human)
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2196 (FAT2)
   04515 Cell adhesion molecules [BR:hsa04515]
    2196 (FAT2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2196 (FAT2)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Cadherin related
   2196 (FAT2)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Laminin_G_2 RET_CLD1 Laminin_G_1 EGF EGF_2
Other DBs
NCBI-GeneID: 2196
NCBI-ProteinID: NP_001438
OMIM: 604269
HGNC: 3596
Ensembl: ENSG00000086570
Pharos: Q9NYQ8(Tdark)
UniProt: Q9NYQ8 Q6PIA2
Position
5:complement(151504092..151594819)
AA seq 4349 aa
MTIALLGFAIFLLHCATCEKPLEGILSSSAWHFTHSHYNATIYENSSPKTYVESFEKMGI
YLAEPQWAVRYRIISGDVANVFKTEEYVVGNFCFLRIRTKSSNTALLNREVRDSYTLIIQ
ATEKTLELEALTRVVVHILDQNDLKPLFSPPSYRVTISEDMPLKSPICKVTATDADLGQN
AEFYYAFNTRSEMFAIHPTSGVVTVAGKLNVTWRGKHELQVLAVDRMRKISEGNGFGSLA
ALVVHVEPALRKPPAIASVVVTPPDSNDGTTYATVLVDANSSGAEVESVEVVGGDPGKHF
KAIKSYARSNEFSLVSVKDINWMEYLHGFNLSLQARSGSGPYFYSQIRGFHLPPSKLSSL
KFEKAVYRVQLSEFSPPGSRVVMVRVTPAFPNLQYVLKPSSENVGFKLNARTGLITTTKL
MDFHDRAHYQLHIRTSPGQASTVVVIDIVDCNNHAPLFNRSSYDGTLDENIPPGTSVLAV
TATDRDHGENGYVTYSIAGPKALPFSIDPYLGIISTSKPMDYELMKRIYTFRVRASDWGS
PFRREKEVSIFLQLRNLNDNQPMFEEVNCTGSIRQDWPVGKSIMTMSAIDVDELQNLKYE
IVSGNELEYFDLNHFSGVISLKRPFINLTAGQPTSYSLKITASDGKNYASPTTLNITVVK
DPHFEVPVTCDKTGVLTQFTKTILHFIGLQNQESSDEEFTSLSTYQINHYTPQFEDHFPQ
SIDVLESVPINTPLARLAATDPDAGFNGKLVYVIADGNEEGCFDIELETGLLTVAAPLDY
EATNFYILNVTVYDLGTPQKSSWKLLTVNVKDWNDNAPRFPPGGYQLTISEDTEVGTTIA
ELTTKDADSEDNGRVRYTLLSPTEKFSLHPLTGELVVTGHLDRESEPRYILKVEARDQPS
KGHQLFSVTDLIITLEDVNDNSPQCITEHNRLKVPEDLPPGTVLTFLDASDPDLGPAGEV
RYVLMDGAHGTFRVDLMTGALILERELDFERRAGYNLSLWASDGGRPLARRTLCHVEVIV
LDVNENLHPPHFASFVHQGQVQENSPSGTQVIVVAAQDDDSGLDGELQYFLRAGTGLAAF
SINQDTGMIQTLAPLDREFASYYWLTVLAVDRGSVPLSSVTEVYIEVTDANDNPPQMSQA
VFYPSIQEDAPVGTSVLQLDAWDPDSSSKGKLTFNITSGNYMGFFMIHPVTGLLSTAQQL
DRENKDEHILEVTVLDNGEPSLKSTSRVVVGILDVNDNPPIFSHKLFNVRLPERLSPVSP
GPVYRLVASDLDEGLNGRVTYSIEDSDEEAFSIDLVTGVVSSSSTFTAGEYNILTIKATD
SGQPPLSASVRLHIEWIPWPRPSSIPLAFDETYYSFTVMETDPVNHMVGVISVEGRPGLF
WFNISGGDKDMDFDIEKTTGSIVIARPLDTRRRSNYNLTVEVTDGSRTIATQVHIFMIAN
INHHRPQFLETRYEVRVPQDTVPGVELLRVQAIDQDKGKSLIYTIHGSQDPGSASLFQLD
PSSGVLVTVGKLDLGSGPSQHTLTVMVRDQEIPIKRNFVWVTIHVEDGNLHPPRFTQLHY
EASVPDTIAPGTELLQVRAMDADRGVNAEVHYSLLKGNSEGFFNINALLGIITLAQKLDQ
ANHAPHTLTVKAEDQGSPQWHDLATVIIHVYPSDRSAPIFSKSEYFVEIPESIPVGSPIL
LVSAMSPSEVTYELREGNKDGVFSMNSYSGLISTQKKLDHEKISSYQLKIRGSNMAGAFT
DVMVVVDIIDENDNAPMFLKSTFVGQISEAAPLYSMIMDKNNNPFVIHASDSDKEANSLL
VYKILEPEALKFFKIDPSMGTLTIVSEMDYESMPSFQFCVYVHDQGSPVLFAPRPAQVII
HVRDVNDSPPRFSEQIYEVAIVGPIHPGMELLMVRASDEDSEVNYSIKTGNADEAVTIHP
VTGSISVLNPAFLGLSRKLTIRASDGLYQDTALVKISLTQVLDKSLQFDQDVYWAAVKEN
LQDRKALVILGAQGNHLNDTLSYFLLNGTDMFHMVQSAGVLQTRGVAFDREQQDTHELAV
EVRDNRTPQRVAQGLVRVSIEDVNDNPPKFKHLPYYTIIQDGTEPGDVLFQVSATDEDLG
TNGAVTYEFAEDYTYFRIDPYLGDISLKKPFDYQALNKYHLKVIARDGGTPSLQSEEEVL
VTVRNKSNPLFQSPYYKVRVPENITLYTPILHTQARSPEGLRLIYNIVEEEPLMLFTTDF
KTGVLTVTGPLDYESKTKHVFTVRATDTALGSFSEATVEVLVEDVNDNPPTFSQLVYTTS
ISEGLPAQTPVIQLLASDQDSGRNRDVSYQIVEDGSDVSKFFQINGSTGEMSTVQELDYE
AQQHFHVKVRAMDKGDPPLTGETLVVVNVSDINDNPPEFRQPQYEANVSELATCGHLVLK
VQAIDPDSRDTSRLEYLILSGNQDRHFFINSSSGIISMFNLCKKHLDSSYNLRVGASDGV
FRATVPVYINTTNANKYSPEFQQHLYEAELAENAMVGTKVIDLLAIDKDSGPYGTIDYTI
INKLASEKFSINPNGQIATLQKLDRENSTERVIAIKVMARDGGGRVAFCTVKIILTDEND
NPPQFKASEYTVSIQSNVSKDSPVIQVLAYDADEGQNADVTYSVNPEDLVKDVIEINPVT
GVVKVKDSLVGLENQTLDFFIKAQDGGPPHWNSLVPVRLQVVPKKVSLPKFSEPLYTFSA
PEDLPEGSEIGIVKAVAAQDPVIYSLVRGTTPESNKDGVFSLDPDTGVIKVRKPMDHEST
KLYQIDVMAHCLQNTDVVSLVSVNIQVGDVNDNRPVFEADPYKAVLTENMPVGTSVIQVT
AIDKDTGRDGQVSYRLSADPGSNVHELFAIDSESGWITTLQELDCETCQTYHFHVVAYDH
GQTIQLSSQALVQVSITDENDNAPRFASEEYRGSVVENSEPGELVATLKTLDADISEQNR
QVTCYITEGDPLGQFGISQVGDEWRISSRKTLDREHTAKYLLRVTASDGKFQASVTVEIF
VLDVNDNSPQCSQLLYTGKVHEDVFPGHFILKVSATDLDTDTNAQITYSLHGPGAHEFKL
DPHTGELTTLTALDRERKDVFNLVAKATDGGGRSCQADITLHVEDVNDNAPRFFPSHCAV
AVFDNTTVKTPVAVVFARDPDQGANAQVVYSLPDSAEGHFSIDATTGVIRLEKPLQVRPQ
APLELTVRASDLGTPIPLSTLGTVTVSVVGLEDYLPVFLNTEHSVQVPEDAPPGTEVLQL
ATLTRPGAEKTGYRVVSGNEQGRFRLDARTGILYVNASLDFETSPKYFLSIECSRKSSSS
LSDVTTVMVNITDVNEHRPQFPQDPYSTRVLENALVGDVILTVSATDEDGPLNSDITYSL
IGGNQLGHFTIHPKKGELQVAKALDREQASSYSLKLRATDSGQPPLHEDTDIAIQVADVN
DNPPRFFQLNYSTTVQENSPIGSKVLQLILSDPDSPENGPPYSFRITKGNNGSAFRVTPD
GWLVTAEGLSRRAQEWYQLQIQASDSGIPPLSSLTSVRVHVTEQSHYAPSALPLEIFITV
GEDEFQGGMVGKIHATDRDPQDTLTYSLAEEETLGRHFSVGAPDGKIIAAQGLPRGHYSF
NVTVSDGTFTTTAGVHVYVWHVGQEALQQAMWMGFYQLTPEELVSDHWRNLQRFLSHKLD
IKRANIHLASLQPAEAVAGVDVLLVFEGHSGTFYEFQELASIITHSAKEMEHSVGVQMRS
AMPMVPCQGPTCQGQICHNTVHLDPKVGPTYSTARLSILTPRHHLQRSCSCNGTATRFSG
QSYVRYRAPAARNWHIHFYLKTLQPQAILLFTNETASVSLKLASGVPQLEYHCLGGFYGN
LSSQRHVNDHEWHSILVEEMDASIRLMVDSMGNTSLVVPENCRGLRPERHLLLGGLILLH
SSSNVSQGFEGCLDAVVVNEEALDLLAPGKTVAGLLETQALTQCCLHSDYCSQNTCLNGG
KCSWTHGAGYVCKCPPQFSGKHCEQGRENCTFAPCLEGGTCILSPKGASCNCPHPYTGDR
CEMEARGCSEGHCLVTPEIQRGDWGQQELLIITVAVAFIIISTVGLLFYCRRCKSHKPVA
MEDPDLLARSVGVDTQAMPAIELNPLSASSCNNLNQPEPSKASVPNELVTFGPNSKQRPV
VCSVPPRLPPAAVPSHSDNEPVIKRTWSSEEMVYPGGAMVWPPTYSRNERWEYPHSEVTQ
GPLPPSAHRHSTPVVMPEPNGLYGGFPFPLEMENKRAPLPPRYSNQNLEDLMPSRPPSPR
ERLVAPCLNEYTAISYYHSQFRQGGGGPCLADGGYKGVGMRLSRAGPSYAVCEVEGAPLA
GQGQPRVPPNYEGSDMVESDYGSCEEVMF
NT seq 13050 nt   +upstreamnt  +downstreamnt
atgactattgccctgctgggttttgccatattcttgctccattgtgcgacctgtgagaag
cctctagaagggattctctcctcctctgcttggcacttcacacactcccattacaatgcc
accatctatgaaaattcttctcccaagacctatgtggagagcttcgagaaaatgggcatc
tacctcgcggagccacagtgggcagtgaggtaccggatcatctctggggatgtggccaat
gtatttaaaactgaggagtatgtggtgggcaacttctgcttcctaagaataaggacaaag
agcagcaacacagctcttctgaacagagaggtgcgagacagctacaccctcatcatccaa
gccacagagaagaccttggagttggaagctttgacccgtgtggtggtccacatcctggac
cagaatgacctgaagcctctcttctctccaccttcgtacagagtcaccatctctgaggac
atgcccctgaagagccccatctgcaaggtgactgccacagatgctgatctaggccagaat
gctgagttctattatgcctttaacacaaggtcagagatgtttgccatccatcccaccagc
ggtgtggtcactgtggctgggaagcttaacgtcacctggcgaggaaagcatgagctccag
gtgctagctgtggaccgcatgcggaaaatctctgagggcaatgggtttggcagcctggct
gcacttgtggttcatgtggagcctgccctcaggaagcccccagccattgcttcggtggtg
gtgactccaccagacagcaatgatggtaccacctatgccactgtactggtcgatgcaaat
agctcaggagctgaagtggagtcagtggaagttgttggtggtgaccctggaaagcacttc
aaagccatcaagtcttatgcccggagcaatgagttcagtttggtgtctgtcaaagacatc
aactggatggagtaccttcatgggttcaacctcagcctccaggccaggagtgggagcggc
ccttatttttattcccagatcaggggctttcacctaccaccttccaaactgtcttccctc
aaattcgagaaggctgtttacagagtgcagcttagtgagttttcccctcctggcagccgc
gtggtgatggtgagagtcaccccagccttccccaacctgcagtatgttctaaagccatct
tcagagaatgtaggatttaaacttaatgctcgaactgggttgatcaccaccacaaagctc
atggacttccacgacagagcccactatcagctacacatcagaacctcaccgggccaggcc
tccaccgtggtggtcattgacattgtggactgcaacaaccatgcccccctcttcaacagg
tcttcctatgatggtaccttggatgagaacatccctccaggcaccagtgttttggctgtg
actgccactgaccgggatcatggggaaaatggatatgtcacctattccattgctggacca
aaagctttgccattttctattgacccctacctggggatcatctccacctccaaacccatg
gactatgaactcatgaaaagaatttataccttccgggtaagagcatcagactggggatcc
ccttttcgccgggagaaggaagtgtccatttttcttcagctcaggaacttgaatgacaac
cagcctatgtttgaagaagtcaactgtacagggtctatccgccaagactggccagtaggg
aaatcgataatgactatgtcagccatagatgtggatgagcttcagaacctaaaatacgag
attgtatcaggcaatgaactagagtattttgatctaaatcatttctccggagtgatatcc
ctcaaacgcccttttatcaatcttactgctggtcaacccaccagttattccctgaagatt
acagcctcagatggcaaaaactatgcctcacccacaactttgaatattactgtggtgaag
gaccctcattttgaagttcctgtaacatgtgataaaacaggggtattgacacaattcaca
aagactatcctccactttattgggcttcagaaccaggagtccagtgatgaggaattcact
tctttaagcacatatcagattaatcattacaccccacagtttgaggaccacttcccccaa
tccattgatgtccttgagagtgtccctatcaacacccccttggcccgcctagcagccact
gaccctgatgctggttttaatggcaaactggtctatgtgattgcagatggcaatgaggag
ggctgctttgacatagagctggagacagggctgctcactgtagctgctcccttggactat
gaagccaccaatttctacatcctcaatgtaacagtatatgacctgggcacaccccagaag
tcctcctggaagctgctgacagtgaatgtgaaagactggaatgacaacgcacccagattt
cctcccggtgggtaccagttaaccatctcggaggacacagaagttggaaccacaattgca
gagctgacaaccaaagatgctgactcggaagacaatggcagggttcgctacaccctgcta
agtcccacagagaagttctccctccaccctctcactggggaactggttgttacaggacac
ctggaccgcgaatcagagcctcggtacatactcaaggtggaggccagggatcagcccagc
aaaggccaccagctcttctctgtcactgacctgataatcacattggaggatgtcaacgac
aactctccccagtgcatcacagaacacaacaggctgaaggttccagaggacctgcccccc
gggactgtcttgacatttctggatgcctctgatcctgacctgggccccgcaggtgaagtg
cgatatgttctgatggatggcgcccatgggaccttccgggtggacctgatgacaggggcg
ctcattctggagagagagctggactttgagaggcgagctgggtacaatctgagcctgtgg
gccagtgatggtgggaggcccctagcccgcaggactctctgccatgtggaggtgatcgtc
ctggatgtgaatgagaatctccaccctccccactttgcctccttcgtgcaccagggccag
gtgcaggagaacagcccctcgggaactcaggtgattgtagtggctgcccaggacgatgac
agtggcttggatggggagctccagtacttcctgcgtgctggcactggactcgcagccttc
agcatcaaccaagatacaggaatgattcagactctggcacccctggaccgagaatttgca
tcttactactggttgacggtattagcagtggacaggggttctgtgcccctctcttctgta
actgaagtctacatcgaggttacggatgccaatgacaacccaccccagatgtcccaagct
gtgttctacccctccatccaggaggatgctcccgtgggcacctctgtgcttcaactggat
gcctgggacccagactccagctccaaagggaagctgaccttcaacatcaccagtgggaac
tacatgggattctttatgattcaccctgttacaggtctcctatctacagcccagcagctg
gacagagagaacaaggatgaacacatcctggaggtgactgtgctggacaatggggaaccc
tcactgaagtccacctccagggtggtggtaggcatcttggacgtcaatgacaatccacct
atattctcccacaagctcttcaatgtccgccttccagagaggctgagccctgtgtcccct
gggcctgtgtacaggctggtggcttcagacctggatgagggtcttaatggcagagtcacc
tacagtatcgaggacagcgatgaggaggccttcagtatcgacctggtcacaggtgtggtt
tcatccagcagcacttttacagctggagagtacaacatcctaacgatcaaggcaacagac
agtgggcagccaccactctcagccagtgtccggctacacattgagtggatcccttggccc
cggccgtcctccatccctctggcctttgatgagacctactacagctttacggtcatggag
acggaccctgtgaaccacatggtgggggtcatcagcgtagagggcagacccggactcttc
tggttcaacatctcaggtggggataaggacatggactttgacattgagaagaccacaggc
agcatcgtcattgccaggcctcttgataccaggagaaggtcgaactataacttgactgtt
gaggtgacagatgggtcccgcaccattgccacacaggtccacatcttcatgattgccaac
attaaccaccatcggccccagtttctggaaactcgttatgaagtcagagttccccaggac
accgtgccaggggtagagctcctgcgagtccaggccatagatcaagacaagggcaaaagc
ctcatctataccatacatggcagccaagacccaggaagtgccagcctcttccagctggac
ccaagcagtggtgtcctggtaacggtgggaaaattggacctcggctcggggccctcccag
cacacactgacagtcatggtccgagaccaggaaatacctatcaagaggaacttcgtgtgg
gtgaccattcatgtggaggatggaaacctccacccaccccgcttcactcagctccattat
gaggcaagtgttcctgacaccatagcccccggcacagagctgctgcaggtccgagccatg
gatgctgaccggggagtcaatgctgaggtccactactccctcctgaaagggaacagcgaa
ggtttcttcaacatcaatgccctgctaggcatcattactctagctcaaaagcttgatcag
gcaaatcatgccccacatactctgacagtgaaggcagaagatcaaggctccccacaatgg
catgacctggctacagtgatcattcatgtctatccctcagataggagtgcccccatcttt
tcaaaatctgagtactttgtagagatccctgaatcaatccctgttggttccccaatcctc
cttgtctctgctatgagcccctctgaagttacctatgagttaagagagggaaataaggat
ggagtcttctctatgaactcatattctggccttatttccacccagaagaaattggaccat
gagaaaatctcgtcttaccagctgaaaatccgaggcagcaatatggcaggtgcatttact
gatgtcatggtggtggttgacataattgatgaaaatgacaatgctcctatgttcttaaag
tcaacttttgtgggccaaattagtgaagcagctccactgtatagcatgatcatggataaa
aacaacaacccctttgtgattcatgcctctgacagtgacaaagaagctaattccttgttg
gtctataaaattttggagccggaggccttgaagtttttcaaaattgatcccagcatggga
accctaaccattgtatcagagatggattatgagagcatgccctctttccaattctgtgtc
tatgtccatgaccaaggaagccctgtattatttgcacccagacctgcccaagtcatcatt
catgtcagagatgtgaatgattcccctcccagattctcagaacagatatatgaggtagca
atagtcgggcctatccatccaggcatggagcttctcatggtgcgggccagcgatgaagac
tcagaagtcaattatagcatcaaaactggcaatgctgatgaagctgttaccatccatcct
gtcactggtagcatatctgtgctgaatcctgctttcctgggactctctcggaagctcacc
atcagggcttctgatggcttgtatcaagacactgcgctggtaaaaatttctttgacccaa
gtgcttgacaaaagcttgcagtttgatcaggatgtctactgggcagctgtgaaggagaac
ttgcaggacagaaaggcactggtgattcttggtgcccagggcaatcatttgaatgacacc
ctttcctactttctcttgaatggcacagatatgtttcatatggtccagtcagcaggtgtg
ttgcagacaagaggtgtggcgtttgaccgggagcagcaggacactcatgagttggcagtg
gaagtgagggacaatcggacacctcagcgggtggctcagggtttggtcagagtctctatt
gaggatgtcaatgacaatccccccaaatttaagcatctgccctattacacaatcatccaa
gatggcacagagccaggggatgtcctctttcaggtatctgccactgatgaggacttgggg
acaaatggggctgttacatatgaatttgcagaagattacacatatttccgaattgacccc
tatcttggggacatatcactcaagaaaccctttgattatcaagctttaaataaatatcac
ctcaaagtcattgctcgggatggaggaacgccatccctccagagtgaggaagaggtactt
gtcactgtgagaaataaatccaacccactgtttcagagtccttattacaaagtcagagta
cctgaaaatatcaccctctataccccaattctccacacccaggcccggagtccagaggga
ctccggctcatctacaacattgtggaggaagaacccttgatgctgttcaccactgacttc
aagactggtgtcctaacagtaacagggcctttggactatgagtccaagaccaaacatgtg
ttcacagtcagagccacggatacagctctggggtcattttctgaagccacagtggaagtc
ctagtggaggatgtcaatgataaccctcccactttttcccaattggtctataccacttcc
atctcagaaggcttgcctgctcagacccctgtgatccaactgttggcttctgaccaggac
tcagggcggaaccgtgacgtctcttatcagattgtggaggatggctcagatgtttccaag
ttcttccagatcaatgggagcacaggggagatgtccacagttcaagaactggattatgaa
gcccaacaacactttcatgtgaaagtcagggccatggataaaggagatcccccactcact
ggtgaaacccttgtggttgtcaatgtgtctgatatcaatgacaaccccccagagttcaga
caacctcaatatgaagccaatgtcagtgaactggcaacctgtggacacctggttcttaaa
gtccaggctattgaccctgacagcagagacacctcccgcctggagtacctgattctttct
ggcaatcaggacaggcacttcttcattaacagctcatcgggaataatttctatgttcaac
ctttgcaaaaagcacctggactcttcttacaatttgagggtaggtgcttctgatggagtc
ttccgagcaactgtgcctgtgtacatcaacactacaaatgccaacaagtacagcccagag
ttccagcagcacctttatgaggcagaattagcagagaatgcaatggttggaaccaaggtg
attgatttgctagccatagacaaagatagtggtccctatggcactatagattatactatc
atcaataaactagcaagtgagaagttctccataaaccccaatggccagattgccactctg
cagaaactggatcgggaaaattcaacagagagagtcattgctattaaggtcatggctcgg
gatggaggaggaagagtagccttctgcacggtgaagatcatcctcacagatgaaaatgac
aaccccccacagttcaaagcatctgagtacacagtatccattcaatccaatgtcagtaaa
gactctccggttatccaggtgttggcctatgatgcagatgaaggtcagaacgcagatgtc
acctactcagtgaacccagaggacctagttaaagatgtcattgaaattaacccagtcact
ggtgtggtcaaggtgaaagacagcctggtgggattggaaaatcagacccttgacttcttc
atcaaagcccaagatggaggccctcctcactggaactctctggtgccagtacgacttcag
gtggttcctaaaaaagtatccttaccgaaattttctgaacctttgtatactttctctgca
cctgaagaccttccagaggggtctgaaattgggattgttaaagcagtggcagctcaagat
ccagtcatctacagtctagtgcggggcactacacctgagagcaacaaggatggtgtcttc
tccctagacccagacacaggggtcataaaggtgaggaagcccatggaccacgaatccacc
aaattgtaccagattgatgtgatggcacattgccttcagaacactgatgtggtgtccttg
gtctctgtcaacatccaagtgggagacgtcaatgacaataggcctgtatttgaggctgat
ccatataaggctgtcctcactgagaatatgccagtggggacctcagtcattcaagtgact
gccattgacaaggacactgggagagatggccaggtgagctacaggctgtctgcagaccct
ggtagcaatgtccatgagctctttgccattgacagtgagagtggttggatcaccacactc
caggaacttgactgtgagacctgccagacttatcattttcatgtggtggcctatgaccac
ggacagaccatccagctatcctctcaggccctggttcaggtctccattacagatgagaat
gacaatgctccccgatttgcttctgaagagtacagaggatctgtggttgagaacagtgag
cctggcgaactggtggcgactctaaagaccctggatgctgacatttctgagcagaacagg
caggtcacctgctacatcacagagggagaccccctgggccagtttggcatcagccaagtt
ggagatgagtggaggatttcctcaaggaagaccctggaccgcgagcatacagccaagtac
ttgctcagagtcacagcatctgatggcaagttccaggcttcggtcactgtggagatcttt
gtcctggacgtcaatgataacagcccacagtgttcacagcttctctatactggcaaggtt
catgaagatgtatttccaggacacttcattttgaaggtttctgccacagacttggacact
gataccaatgctcagatcacatattctctgcatggccctggggcgcatgaattcaagctg
gatcctcatacaggggagctgaccacactcactgccctagaccgagaaaggaaggatgtg
ttcaaccttgttgccaaggcgacggatggaggtggccgatcgtgccaggcagacatcacc
ctccatgtggaggatgtgaatgacaatgccccgcggttcttccccagccactgtgctgtg
gctgtcttcgacaacaccacagtgaagacccctgtggctgtagtatttgcccgggatccc
gaccaaggcgccaatgcccaggtggtttactctctgccggattcagccgaaggccacttt
tccatcgacgccaccacgggggtgatccgcctggaaaagccgctgcaggtcaggccccag
gcaccactggagctcacggtccgtgcctctgacctgggcaccccaataccgctgtccacg
ctgggcaccgtcacagtctcggtggtgggcctagaagactacctgcccgtgttcctgaac
accgagcacagcgtgcaggtgcccgaggacgccccacctggcacggaggtgctgcagctg
gccaccctcactcgcccgggcgcagagaagaccggctaccgcgtggtcagcgggaacgag
caaggcaggttccgcctggatgctcgcacagggatcctgtatgtcaacgcaagcctggac
tttgagacaagccccaagtacttcctgtccattgagtgcagccggaagagctcctcttcc
ctcagtgacgtgaccacagtcatggtcaacatcactgatgtcaatgaacaccggccccaa
ttcccccaagatccatatagcacaagggtcttagagaatgcccttgtgggtgacgtcatc
ctcacggtatcagcgactgatgaagatggacccctaaatagtgacattacctatagcctc
ataggagggaaccagcttgggcacttcaccattcaccccaaaaagggggagctacaggtg
gccaaggccctggaccgggaacaggcctctagttattccctgaagctccgagccacagac
agtgggcagcctccactgcatgaggacacagacatcgctatccaagtggctgatgtcaat
gataacccaccgagattcttccagctcaactacagcaccactgtccaggagaactccccc
attggcagcaaagtcctgcagctgatcctgagtgacccagattctccagagaatggcccc
ccctactcgtttcgaatcaccaaggggaacaacggctctgccttccgagtgaccccggat
ggatggctggtgactgctgagggcctaagcaggagggctcaggaatggtatcagcttcag
atccaggcgtcagacagtggcatccctcccctctcgtctttgacgtctgtccgtgtccat
gtcacagagcagagccactatgcaccttctgctctcccactggagatcttcatcactgtt
ggagaggatgagttccagggtggcatggtgggtaagatccatgccacagaccgagacccc
caggacacgctgacctatagcctggcagaagaggagaccctgggcaggcacttctcagtg
ggtgcgcctgatggcaagattatcgccgcccagggcctgcctcgtggccactactcgttc
aacgtcacggtcagcgatgggaccttcaccacgactgctggggtccatgtgtacgtgtgg
catgtggggcaggaggctctgcagcaggccatgtggatgggcttctaccagctcaccccc
gaggagctggtgagtgaccactggcggaacctgcagaggttcctcagccataagctggac
atcaaacgggctaacattcacttggccagcctccagcctgcagaggccgtggctggtgtg
gatgtgctcctggtctttgaggggcattctggaaccttctacgagtttcaggagctagca
tccatcatcactcactcagccaaggagatggagcattcagtgggggttcagatgcggtca
gctatgcccatggtgccctgccaggggccaacctgccagggtcaaatctgccataacaca
gtgcatctggaccccaaggttgggcccacgtacagcaccgccaggctcagcatcctaacc
ccgcggcaccacctgcagaggagctgctcctgcaatggtactgctacaaggttcagtggt
cagagctatgtgcggtacagggccccagcggctcggaactggcacatccatttctatctg
aaaacactccagccacaggccattcttctattcaccaatgaaacagcgtccgtctccctg
aagctggccagtggagtgccccagctggaataccactgtctgggtggtttctatggaaac
ctttcctcccagcgccatgtgaatgaccacgagtggcactccatcctggtggaggagatg
gacgcttccattcgcctgatggttgacagcatgggcaacacctcccttgtggtcccagag
aactgccgtggtctgaggcccgaaaggcacctcttgctgggcggcctcattctgttgcat
tcttcctcgaatgtctcccagggctttgaaggctgcctggatgctgtcgtggtcaacgaa
gaggctctagatctgctggcccctggcaagacggtggcaggcttgctggagacacaagcc
ctcacccagtgctgcctccacagtgactactgcagccagaacacatgcctcaatggtggg
aagtgctcatggacccatggggcaggctatgtctgcaaatgtcccccacagttctctggg
aagcactgtgaacaaggaagggagaactgtacttttgcaccctgcctggaaggtggaact
tgcatcctctcccccaaaggagcttcctgtaactgccctcatccttacacaggagacagg
tgtgaaatggaggcgaggggttgttcagaaggacactgcctagtcactcccgagatccaa
aggggggactgggggcagcaggagttactgatcatcacagtggccgtggcgttcattatc
ataagcactgtcgggcttctcttctactgccgccgttgcaagtctcacaagcctgtggcc
atggaggacccagacctcctggccaggagtgttggtgttgacacccaagccatgcctgcc
atcgagctcaacccattgagtgccagctcctgcaacaacctcaaccaaccggaacccagc
aaggcctctgttccaaatgaactcgtcacatttggacccaattctaagcaacggccagtg
gtctgcagtgtgccccccagactcccgccagctgcggtcccttcccactctgacaatgag
cctgtcattaagagaacctggtccagcgaggagatggtgtaccctggcggagccatggtc
tggccccctacttactccaggaacgaacgctgggaatacccccactccgaagtgactcag
ggccctctgccgccctcggctcaccgccactcaaccccagtcgtgatgccagagcctaat
ggcctctatgggggcttccccttccccctggagatggaaaacaagcgggcacctctccca
ccccgttacagcaaccagaacctggaagatctgatgccctctcggccccctagtccccgg
gagcgcctggttgccccctgtctcaatgagtacacggccatcagctactaccactcgcag
ttccggcagggagggggagggccctgcctggcagacgggggctacaagggggtgggtatg
cgcctcagccgagctgggccctcttatgctgtctgtgaggtggagggggcacctcttgca
ggccagggccagccccgggtgccccccaactatgagggctctgacatggtggagagtgat
tatggcagctgtgaggaggtcatgttctag

DBGET integrated database retrieval system