KEGG   Homo sapiens (human): 219621
Entry
219621            CDS       T01001                                 
Symbol
CABCOCO1, C10orf107
Name
(RefSeq) ciliary associated calcium binding coiled-coil 1
  KO
K25644  ciliary-associated calcium-binding coiled-coil protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    219621 (CABCOCO1)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   219621 (CABCOCO1)
SSDB
Motif
Pfam: CLAMP
Other DBs
NCBI-GeneID: 219621
NCBI-ProteinID: NP_775825
HGNC: 28678
Ensembl: ENSG00000183346
Pharos: Q8IVU9(Tdark)
UniProt: Q8IVU9
Position
10:61662929..61766766
AA seq 208 aa
MDFSIIQYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDWNIFDVK
QANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFD
IYSTFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDPLVGFTIEDVKSVLDQVTDDIL
IGIQTEINEKLQIQEEAFNARIEKLKKA
NT seq 627 nt   +upstreamnt  +downstreamnt
atggatttctctattattcagtattcaaaatttatgactttactagctatgtcacttcaa
aatcttaaaacactacatatgtccttagaggaaagcataaaatggcttggagaagttatg
gctgaaataggaccaacacattcgcaaaagagtgaggactggaatatctttgatgtaaaa
caagccaatgctatcattgattacttaaaaatcagcttatttcaacactacaagctatac
gagtttatgttctactctgccagggaagaaattgtgataggaactgagcaagtgatagag
gttgtcaagtctgcatgtggccctttcccaaatcctctggaagaaggaatctcatttgat
atttattcaacattcatagagccccccacaatattggatacggaaatgaagaggttggat
caagaacaaggccctgaggagtctcagccagaaactgacacctcagacatggatccttta
gttggttttaccattgaagatgtaaaatcagtgctggatcaagtcacagatgacatttta
atcggcattcagaccgagataaacgaaaaactgcaaatacaggaagaggcctttaatgca
cgaatagaaaaattgaaaaaggcctaa

DBGET integrated database retrieval system