KEGG   Homo sapiens (human): 219699Help
Entry
219699            CDS       T01001                                 

Gene name
UNC5B, UNC5H2, p53RDL1
Definition
(RefSeq) unc-5 netrin receptor B
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    219699 (UNC5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 219699
NCBI-ProteinID: NP_734465
OMIM: 607870
HGNC: 12568
Ensembl: ENSG00000107731
Vega: OTTHUMG00000018422
Pharos: Q8IZJ1(Tbio)
UniProt: Q8IZJ1
Position
10q22.1
AA seq 945 aa AA seqDB search
MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSL
KVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccggagcggagctcggggcgcgctgctgctggcactgctgctctgctgggac
ccgaggctgagccaagcaggcactgattctggcagcgaggtgctccctgactccttcccg
tcagcgccagcagagccgctgccctacttcctgcaggagccacaggacgcctacattgtg
aagaacaagcctgtggagctccgctgccgcgccttccccgccacacagatctacttcaag
tgcaacggcgagtgggtcagccagaacgaccacgtcacacaggaaggcctggatgaggcc
accggcctgcgggtgcgcgaggtgcagatcgaggtgtcgcggcagcaggtggaggagctc
tttgggctggaggattactggtgccagtgcgtggcctggagctccgcgggcaccaccaag
agtcgccgagcctacgtccgcatcgcctacctgcgcaagaacttcgatcaggagcctctg
ggcaaggaggtgcccctggaccatgaggttctcctgcagtgccgcccgccggagggggtg
cctgtggccgaggtggaatggctcaagaatgaggatgtcatcgaccccacccaggacacc
aacttcctgctcaccatcgaccacaacctcatcatccgccaggcccgcctgtcggacact
gccaactatacctgcgtggccaagaacatcgtggccaaacgccggagcaccactgccacc
gtcatcgtctacgtgaatggcggctggtccagctgggcagagtggtcaccctgctccaac
cgctgtggccgaggctggcagaagcgcacccggacctgcaccaaccccgctccactcaac
ggaggggccttctgcgagggccaggcattccagaagaccgcctgcaccaccatctgccca
gtcgatggggcgtggacggagtggagcaagtggtcagcctgcagcactgagtgtgcccac
tggcgtagccgcgagtgcatggcgcccccaccccagaacggaggccgtgactgcagcggg
acgctgctcgactctaagaactgcacagatgggctgtgcatgcaaaataagaaaactcta
agcgaccccaacagccacctgctggaggcctcaggggatgcggcgctgtatgcggggctc
gtggtggccatcttcgtggtcgtggcaatcctcatggcggtgggggtggtggtgtaccgc
cgcaactgccgtgacttcgacacagacatcactgactcatctgctgccctgactggtggt
ttccaccccgtcaactttaagacggcaaggcccagcaacccgcagctcctacacccctct
gtgcctcctgacctgacagccagcgccggcatctaccgcggacccgtgtatgccctgcag
gactccaccgacaaaatccccatgaccaactctcctctgctggaccccttacccagcctt
aaggtcaaggtctacagctccagcaccacgggctctgggccaggcctggcagatggggct
gacctgctgggggtcttgccgcctggcacataccctagcgatttcgcccgggacacccac
ttcctgcacctgcgcagcgccagcctcggttcccagcagctcttgggcctgccccgagac
ccagggagcagcgtcagcggcacctttggctgcctgggtgggaggctcagcatccccggc
acaggggtcagcttgctggtgcccaatggagccattccccagggcaagttctacgagatg
tatctactcatcaacaaggcagaaagtaccctcccgctttcagaagggacccagacagta
ttgagcccctcggtgacctgtggacccacaggcctcctgctgtgccgccccgtcatcctc
accatgccccactgtgccgaagtcagtgcccgtgactggatctttcagctcaagacccag
gcccaccagggccactgggaggaggtggtgaccctggatgaggagaccctgaacacaccc
tgctactgccagctggagcccagggcctgtcacatcctgctggaccagctgggcacctac
gtgttcacgggcgagtcctattcccgctcagcagtcaagcggctccagctggccgtcttc
gcccccgccctctgcacctccctggagtacagcctccgggtctactgcctggaggacacg
cctgtagcactgaaggaggtgctggagctggagcggactctgggcggatacttggtggag
gagccgaaaccgctaatgttcaaggacagttaccacaacctgcgcctctccctccatgac
ctcccccatgcccattggaggagcaagctgctggccaaataccaggagatccccttctat
cacatttggagtggcagccagaaggccctccactgcactttcaccctggagaggcacagc
ttggcctccacagagctcacctgcaagatctgcgtgcggcaagtggaaggggagggccag
atattccagctgcataccactctggcagagacacctgctggctccctggacactctctgc
tctgcccctggcagcactgtcaccacccagctgggaccttatgccttcaagatcccactg
tccatccgccagaagatatgcaacagcctagatgcccccaactcacggggcaatgactgg
cggatgttagcacagaagctctctatggaccggtacctgaattactttgccaccaaagcg
agccccacgggtgtgatcctggacctctgggaagctctgcagcaggacgatggggacctc
aacagcctggcgagtgccttggaggagatgggcaagagtgagatgctggtggctgtggcc
accgacggggactgctga

DBGET integrated database retrieval system