KEGG   Homo sapiens (human): 219738
Entry
219738            CDS       T01001                                 
Symbol
FAM241B, C10orf35
Name
(RefSeq) family with sequence similarity 241 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4605
Other DBs
NCBI-GeneID: 219738
NCBI-ProteinID: NP_660349
HGNC: 23519
Ensembl: ENSG00000171224
Pharos: Q96D05(Tdark)
UniProt: Q96D05 A0A024QZL0
Position
10:69630247..69633596
AA seq 121 aa
MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAA
QSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQ
R
NT seq 366 nt   +upstreamnt  +downstreamnt
atggtgcggatcttggccaatggggaaatcgtgcaggatgacgacccccgagtgaggacc
actacccagccaccaagaggtagcattcctcgacagagcttcttcaacaggggccatggt
gctcccccagggggtcctggcccccgccagcagcaggcaggtgccaggctgggtgctgct
cagtcccccttcaatgacctcaaccggcagctggtgaacatgggctttccgcagtggcat
cttggcaaccatgctgtggagccggtgacctccatcctgctcctcttcctgctcatgatg
cttggtgttcgtggcctcctcctggttggccttgtctacctggtgtcccacctgagtcag
cggtga

DBGET integrated database retrieval system