KEGG   Homo sapiens (human): 219858
Entry
219858            CDS       T01001                                 

Gene name
OR8B12, OR11-317
Definition
(RefSeq) olfactory receptor family 8 subfamily B member 12
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219858 (OR8B12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219858 (OR8B12)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219858 (OR8B12)
SSDB
Motif
Pfam: 7tm_4 7tm_1 PTS_EIIB
Other DBs
NCBI-GeneID: 219858
NCBI-ProteinID: NP_001005195
HGNC: 15307
Ensembl: ENSG00000170953
Vega: OTTHUMG00000165922
Pharos: Q8NGG6(Tdark)
UniProt: Q8NGG6 A0A126GWS7
Position
11q24.2
AA seq 310 aa
MAAKNSSVTEFILEGLTHQPGLRIPLFFLFLGFYTVTVVGNLGLITLIGLNSHLHTPMYF
FLFNLSLIDFCFSTTITPKMLMSFVSRKNIISFTGCMTQLFFFCFFVVSESFILSAMAYD
RYVAICNPLLYTVTMSCQVCLLLLLGAYGMGFAGAMAHTGSIMNLTFCADNLVNHFMCDI
LPLLELSCNSSYMNELVVFIVVAVDVGMPIVTVFISYALILSSILHNSSTEGRSKAFSTC
SSHIIVVSLFFGSGAFMYLKPLSILPLEQGKVSSLFYTIIVPVLNPLIYSLRNKDVKVAL
RRTLGRKIFS
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcagccaaaaactcttctgtgacagagtttatcctcgaaggcttaacccaccagccg
ggactgcggatccccctcttcttcctgtttctgggtttctacacggtcaccgtggtgggg
aacctgggcttgataaccctgattgggctgaactctcacctgcacactcccatgtacttc
ttcctttttaacctctctttaatagatttctgtttctccactaccatcactcccaaaatg
ctgatgagttttgtctcaaggaagaacatcatttccttcacagggtgtatgactcagctc
ttcttcttctgcttctttgtcgtctctgagtccttcatcctgtcagcgatggcgtatgac
cgctacgtggccatctgtaacccactgttgtacacagtcaccatgtcttgccaggtgtgt
ttgctccttttgttgggtgcctatgggatggggtttgctggggccatggcccacacagga
agcataatgaacctgaccttctgtgctgacaaccttgtcaatcatttcatgtgtgacatc
cttcctctccttgagctctcctgcaacagctcttacatgaatgagctggtggtctttatt
gtggtggctgttgacgttggaatgcccattgtcactgtctttatttcttatgccctcatc
ctctccagcattctacacaacagttctacagaaggcaggtccaaagcctttagtacttgc
agttcccacataattgtagtttctcttttctttggttctggtgctttcatgtatctcaaa
cccctttccatcctgcccctcgagcaagggaaagtgtcctccctgttctataccataata
gtccccgtgttaaacccattaatctatagcttgaggaacaaggatgtcaaagttgccctg
aggagaactttgggcagaaaaatcttttcttaa

DBGET integrated database retrieval system