KEGG   Homo sapiens (human): 219870
Entry
219870            CDS       T01001                                 

Gene name
OR10G9, OR10G10P
Definition
(RefSeq) olfactory receptor family 10 subfamily G member 9
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    219870 (OR10G9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    219870 (OR10G9)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    219870 (OR10G9)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 219870
NCBI-ProteinID: NP_001001953
HGNC: 15129
Ensembl: ENSG00000236981
Vega: OTTHUMG00000165967
Pharos: Q8NGN4(Tdark)
UniProt: Q8NGN4
Position
11q24.2
AA seq 311 aa
MSKTSLVTAFILTGLPHAPGLDAPLFGIFLVVYVLTVLGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLVSPSGRAISFHSCVAQLYFFHFLGSTECFLYTVMSYD
RYLAISYPLRYTSMMSGSRCALLATSTWLSGSLHSAVQTILTFHLPYCGPNQIQHYLCDA
PPILKLACADTSANEMVIFVDIGLVASGCFLLIVLSYVSIVCSILRIHTSEGRHRAFQTC
ASHCIVVLCFFVPCVFIYLRPGSRDVVDGVVAIFYTVLTPLLNPVVYTLRNKEVKKAVLK
LRDKVAHSQGE
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtccaagaccagcctcgtgacagcgttcatcctcacgggccttccccatgccccaggg
ctggacgccccactctttggaatcttcctggtggtttacgtgctcactgtgctggggaac
ctcctcatcctgctggtgatcagggtggattctcacctccacacccccatgtactacttc
ctcaccaacctgtccttcattgacatgtggttctccactgtcacggtgcccaaaatgctg
atgaccttggtgtccccaagcggcagggctatctccttccacagctgcgtggctcagctc
tattttttccacttcctggggagcaccgagtgtttcctctacacagtcatgtcctatgat
cgctacttggccatcagttacccgctcaggtacaccagcatgatgagtgggagcagatgt
gccctcctggccaccagcacttggctcagtggctctctgcactctgctgtccagaccata
ttgactttccatttgccctactgtggacccaaccagatccagcactatttgtgtgatgca
ccgcccatcctgaaactggcctgtgcagacacctcagccaacgagatggtcatctttgtg
gacattgggctagtggcctcgggctgctttctcctgatagtgctgtcttatgtgtccatc
gtctgttccatcctgcggatccacacctcagaggggaggcacagagcctttcagacctgt
gcctcccactgcatcgtggtcctttgcttttttgttccctgtgttttcatttacctgaga
ccaggctccagggacgtcgtggatggagttgtggccattttctacactgtgctgacaccc
cttctcaaccctgttgtgtacaccctgagaaacaaggaggtgaagaaagctgtgttgaaa
ctgagagacaaagtagcacattctcagggagaataa

DBGET integrated database retrieval system