KEGG   Homo sapiens (human): 219902
Entry
219902            CDS       T01001                                 

Gene name
TLCD5, TMEM136
Definition
(RefSeq) TLC domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8
Other DBs
NCBI-GeneID: 219902
NCBI-ProteinID: NP_001185600
HGNC: 28280
Ensembl: ENSG00000181264
Vega: OTTHUMG00000166142
Pharos: Q6ZRR5(Tdark)
UniProt: Q6ZRR5
Position
11q23.3
AA seq 245 aa
MALALCLQVLCSLCGWLSLYISFCHLNKHRSYEWSCRLVTFTHGVLSIGLSAYIGFIDGP
WPFTHPGSPNTPLQVHVLCLTLGYFIFDLGWCVYFQSEGALMLAHHTLSILGIIMALVLG
ESGTEVNAVLFGSELTNPLLQMRWFLRETGHYHSFTGDVVDFLFVALFTGVRIGVGACLL
FCEMVSPTPKWFVKAGGVAMYAVSWCFMFSIWRFAWRKSIKKYHAWRSRRSEERQLKHNG
HLKIH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcattagctctgtgtctgcaggtgctgtgcagcctgtgtggctggctctcgctctat
atttctttctgccacctgaataagcaccgaagctatgagtggagctgccgcctggtcacc
ttcacccatggagtcctctctataggcctctccgcttatattggcttcattgatggccca
tggccttttacccacccaggctcacccaatacacctctccaagttcatgtcctgtgtctc
accttgggctacttcatcttcgacttgggctggtgcgtctactttcagtctgagggtgcc
ttgatgctggctcatcacacattgagtatcttgggcattatcatggcccttgtgcttggg
gagtctggcacagaggtcaatgcagtcctctttggaagtgagcttaccaaccccttgcta
cagatgcgctggtttctccgggaaacagggcactatcacagtttcactggagatgtagtg
gacttcctctttgtggctctgttcacaggagtgaggattggtgtgggagcttgcctcctt
ttctgtgaaatggtctcccccacgcctaagtggtttgtgaaggctgggggagtagcgatg
tatgctgtgtcttggtgtttcatgtttagcatctggcgctttgcatggaggaagagcatc
aagaagtaccatgcttggagaagcaggcggagtgaggaacggcagctgaaacacaacgga
catctcaaaatacactag

DBGET integrated database retrieval system