KEGG   Homo sapiens (human): 219927Help
Entry
219927            CDS       T01001                                 

Gene name
MRPL21, L21mt, MRP-L21
Definition
(RefSeq) mitochondrial ribosomal protein L21
  KO
K02888  large subunit ribosomal protein L21
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    219927 (MRPL21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    219927 (MRPL21)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    219927 (MRPL21)
  Bacteria
    219927 (MRPL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L21p
Motif
Other DBs
NCBI-GeneID: 219927
NCBI-ProteinID: NP_852615
OMIM: 611834
HGNC: 14479
Ensembl: ENSG00000197345
Vega: OTTHUMG00000167893
Pharos: Q7Z2W9(Tdark)
UniProt: Q7Z2W9
Structure
PDB: 

Position
11q13.3
AA seq 205 aa AA seqDB search
MAASSLTVTLGRLASACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPP
WPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNEL
DLACGERIRLEKVLLVGADNFTLLGKPLLGKDLVRVEATVIEKTESWPRIIMRFRKRKNF
KKKRIVTTPQTVLRINSIEIAPCLL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatcttccctgacggtcaccttagggcggctggcgtccgcgtgcagccacagc
atcctgagaccttcggggcccggagcagcctccctttggtctgcttctcgaaggttcaat
tcacagagcacttcatatctaccaggatatgttcctaaaacatccctgagttcaccacct
tggccagaagttgttctgccagacccagttgaggagaccagacaccatgcagaggtcgtg
aagaaggtgaatgagatgatcgtcacggggcagtatggcaggctctttgccgtggtgcac
tttgccagccgccagtggaaggtgacctctgaagacctgatcttaattggaaatgaacta
gaccttgcgtgtggagagagaattcgactggagaaggtcctgctggttggggcagacaac
ttcacgctgcttggcaagccactcctcggaaaggatcttgttcgagtagaagccacagtc
attgaaaagacagaatcatggccaagaatcattatgagattcaggaaaaggaaaaacttc
aagaagaaaagaatcgtcacgaccccgcagactgtcctccggataaacagcattgagatt
gctccgtgtttgttgtga

DBGET integrated database retrieval system