KEGG   Homo sapiens (human): 219931Help
Entry
219931            CDS       T01001                                 

Gene name
TPCN2, SHEP10, TPC2
Definition
(RefSeq) two pore segment channel 2
  KO
K14077  two pore calcium channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    219931 (TPCN2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    219931 (TPCN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    219931 (TPCN2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, two-pore (TPC)
   219931 (TPCN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans
Motif
Other DBs
NCBI-GeneID: 219931
NCBI-ProteinID: NP_620714
OMIM: 612163
HGNC: 20820
Ensembl: ENSG00000162341
Vega: OTTHUMG00000167898
Pharos: Q8NHX9(Tbio)
UniProt: Q8NHX9 Q59G56
Structure
PDB: 

Position
11q13.3
AA seq 752 aa AA seqDB search
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSL
WDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccccaggcggagtcggagcccctgctgggcggggcccgcggcggtggcggc
gactggccggcggggctgaccacttaccgcagcatccaagtcggccctggtgccgcggcc
aggtgggacctctgcattgatcaggctgtggtcttcatcgaagatgctattcagtaccgc
tccatcaaccaccgggtggatgccagctcgatgtggctttaccgacggtattactcgaac
gtatgccaacggactttgagcttcaccatcttcttgatcctgtttttggcttttatcgag
accccatcctcactcaccagcacggcggacgtgcgctaccgcgctgctccctgggagccg
ccctgcggcctgaccgagagtgtcgaggtgctctgcctgctggtctttgcggccgacctc
tctgtgaagggttacctgttcgggtgggcccatttccagaaaaacctttggctgctgggc
tacctcgtggtgctggtggtgtctctggtggactggaccgtgtccctgagtctcgtgtgt
catgagcccctgcggatccgccggcttctccgtcccttcttcctgctgcagaactcctct
atgatgaagaagaccttgaaatgcatccgctggtcgctgccggaaatggccagcgtcggg
ctgctgctggccatccacctgtgcctcttcaccatgttcggaatgctgctgttcgctggt
gggaagcaggatgatgggcaggacagggagaggctgacctacttccagaacctgcctgag
tctctgacttccctcctggtgctgctgaccacggccaacaaccccgatgtgatgattcct
gcgtattccaagaaccgggcctatgccatcttcttcatagtcttcactgtgataggaagc
ctgtttctgatgaacctgctgacagccatcatctacagtcagttccggggctacctgatg
aaatctctccagacctcgctgtttcggaggcggctgggaacccgggctgcctttgaagtc
ctatcctccatggtgggggagggaggagccttccctcaggcagttggggtgaagccccag
aacttgctgcaggtgcttcagaaggtccagctggacagctcccacaaacaggccatgatg
gagaaggtgcgttcctatggcagtgttctgctctcagctgaggagtttcagaagctcttc
aacgagcttgacagaagtgtggttaaagagcacccgccgaggcccgagtaccagtctccg
tttctgcagagcgcccagttcctcttcggccactactactttgactacctggggaacctc
atcgccctggcaaacctggtgtccatttgcgtgttcctggtgctggatgcagatgtgctg
cctgctgagcgtgatgacttcatcctggggattctcaactgcgtcttcattgtgtactac
ctgttggagatgctgctcaaggtctttgccctgggcctgcgagggtacctgtcctacccc
agcaacgtgtttgacgggctcctcaccgttgtcctgctggttttggagatctcaactctg
gctgtgtaccgattgccacacccaggctggaggccggagatggtgggcctgctgtcgctg
tgggacatgacccgcatgctgaacatgctcatcgtgttccgcttcctgcgtatcatcccc
agcatgaagctgatggccgtggtggccagtaccgtcctgggcctggtgcagaacatgcgt
gcgtttggcgggatcctggtggtggtctactacgtatttgccatcattgggatcaacttg
tttagaggcgtcattgtggctcttcctggaaacagcagcctggcccctgccaatggctcg
gcgccctgtgggagcttcgagcagctggagtactgggccaacaacttcgatgactttgcg
gctgccctggtcactctgtggaacttgatggtggtgaacaactggcaggtgtttctggat
gcatatcggcgctactcaggcccgtggtccaagatctattttgtattgtggtggctggtg
tcgtctgtcatctgggtcaacctgtttctggccctgattctggagaacttccttcacaag
tgggacccccgcagccacctgcagccccttgctgggaccccagaggccacctaccagatg
actgtggagctcctgttcagggatattctggaggagcccggggaggatgagctcacagag
aggctgagccagcacccgcacctgtggctgtgcaggtga

DBGET integrated database retrieval system